DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid-1

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001300004.1 Gene:arid-1 WormBaseID:WBGene00044689 Length:1648 Species:Caenorhabditis elegans

Alignment Length:1864 Identity:351/1865 (19%)
Similarity:543/1865 (29%) Gaps:809/1865 (43%)


  Fly     5 DDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQG-LGSGIVSDDAIKAPTGQLRVGAV 68
            |||..|.:|||||||:|||:||||:.||.|::||||:.|:. .|..||.|:.:  |..:..:..:
 Worm     3 DDPAFLALGTEVSAKFKGAYCEAKIQKVDRSLKVKVSLKESPFGQMIVQDNDL--PNAKFEINEL 65

  Fly    69 VEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLTHPE 133
            .:|..  :::.:...|..|:|.|:|.|||:|||...||||.|.||.|:||.....||.:|||:||
 Worm    66 TDVVF--QRKFIRCQIQSIKDQSKYHVVFNDGDEKELRRTQLVLKGGKHFAADGNLDSMPLTNPE 128

  Fly   134 HFGNPVVGG--RRGRRR--------------------------------GHLNEDSSEDDDESDA 164
            .|..||:.|  :||.::                                |...||:.:|||:::.
 Worm   129 SFSTPVIRGAAKRGAQKIRNAISEASGSRGGAVLLHNDDDENDEEDQEDGENEEDADDDDDDTEE 193

  Fly   165 KE--------------------------------------------------------------- 166
            ::                                                               
 Worm   194 QQQPRERRRAAAISAIGVLKKAIEDTQSEESSADSSEERERARSRRKRKDEASSAVTSDEEDQED 258

  Fly   167 ---------VVN----------------------------EKEENIGKVVCVETESKKKDKEK-- 192
                     |:|                            ::||...|:...|...:||.:||  
 Worm   259 LATTDSENPVINGASSAAALSKTLQRKLEKQAMKREKQRLKEEEREEKLRLKEENREKKRREKAR 323

  Fly   193 ----------------------------------------------------------------- 192
                                                                             
 Worm   324 IMELKRLEKVYRTSNARIQENHEKSMTQIISHRSVRYFARFSDLKHRRKKKKLYLHEHRQKVNSR 388

  Fly   193 ----------------------------------------------------------------- 192
                                                                             
 Worm   389 IRNVKLYFAWRFVAHKARLSYFARYALQWWRTSEDQAYSLIRTEKLLRSQRRRDWVGSWLEGLER 453

  Fly   193 -------------------------------------------------------WFPALVVAPT 202
                                                                   |||| |:.|.
 Worm   454 EKIRFVVIHESYTQARRILKYIERGTEKRTFAERCDIEYEDIESSTVSSHFRDQEWFPA-VLFPQ 517

  Fly   203 A----------QATVR-------IRVKDEYLV-------RSFKDGRYYTVPK--------KEATE 235
            .          |..||       ::|.::.||       .||.|....|..|        |.|..
 Worm   518 VFSDENGSEGRQRIVRHMGNGQLVQVWEDDLVPFDWLPEYSFADVTAMTEKKPVEMRRKFKLAWR 582

  Fly   236 FTREVA-SKQDVPAVQAALEF---------LDSSVLPAH--------WDRDSLFGLTNISSDDEG 282
            |..:.| ::.|..::::.||:         |..:.:|..        .|.|.|     :|:.:|.
 Worm   583 FATDYAQNRLDARSIRSILEWKFIRPSSRRLKITPIPVQAPSPNRCGEDHDDL-----VSTPNES 642

  Fly   283 EIDSDSS-DDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTS 346
            :.|||:: .:...|.||.|||.|.::.|...:.::..|:|...:||||.|:...:|.||..:|.:
 Worm   643 DYDSDATIKNVDAETKDLFVAMLVQFHDAHNSVIDTNPTIQGHEVDLYYLYELAKKTGGPKKVYA 707

  Fly   347 QNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRAN 411
            .|.|...|.:|  .|........:|..:|.||:.|...:.||..                     
 Worm   708 ANLWSDYAKKL--VPAATDAEEELKTIFKNFLESYLAINTKLSW--------------------- 749

  Fly   412 SVASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTS 476
                  |||:::..|..|:..|.|.:......:.|..:.|   .||..|..::            
 Worm   750 ------PMESLQPRTERKVVLPGQYSESRKKRTQAIMSQV---QTPPTAPGSS------------ 793

  Fly   477 ESSVVVEPPKKQRKGSAAS-SQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAM--PTT 538
                     ||.|.||..: .::.||.|  |..:.|....:::|..|.|..|.|....:.  |..
 Worm   794 ---------KKGRVGSGGTRGRKRKVSS--ESVQLKKRNRKSSSRATTASPGPSEDRFSFQRPQD 847

  Fly   539 SAAASTATNLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSA 603
            |   ...|::....:             |.|..||          .|:||...|:::......|.
 Worm   848 S---DDVTDVPDDMT-------------DHEDLLP----------EAATRKKYERKSQTPGRRSL 886

  Fly   604 SASSKANSAEMQRSRDASP---SVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDK 665
            |:          |..|.:|   ..||||..|........|....|..|                 
 Worm   887 SS----------RRDDTTPVSSMAAAPPKKGRPRKNTTVTTPVLSVPK----------------- 924

  Fly   666 EEKQASSGKRKKEKISVEKIDTGDFVVGI--GDKLKVNYHEKKSPSSHGSTYEAKVIEISVQ--- 725
                 |.|:..:::.:..|....:.:..|  |.||:..|.::        .:.|..||.:..   
 Worm   925 -----SEGRGPRKEDTTTKFVRANVLSHILSGQKLRAFYGDE--------WFRANAIEDATDCTD 976

  Fly   726 ------------------RGVPMYL-------------VHYTGWNNRYDEWVPRERIA------- 752
                              |..|..:             .||||||.||||::..|::.       
 Worm   977 EIMDIMLAHQDFFTPDTPRLSPSAIQDLDKVLKKIRAKTHYTGWNQRYDEFMKLEKLMVTVEDQM 1041

  Fly   753 ------ENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQ-----GSQPPGV 806
                  .:|.:|.:.|..|::                             ||:     ..:..||
 Worm  1042 IARGRFRHLPRGRELKAETLA-----------------------------LVEKHFRADDEDDGV 1077

  Fly   807 -----------------SDKQPGKDGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKT 854
                             |:|:...|........:.....|...:.:...||.|.:..  ....||
 Worm  1078 PKTLAFYLKIAQEALSLSEKRAVADDDESSDSDTDFEQKPDTSAAAAVNGGKSESEE--EEEEKT 1140

  Fly   855 PPTGGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVS 919
            ...||        |...........|:..|...:||    |...|           |||||...:
 Worm  1141 VVMGG--------DEEAEEEVKSEDVLVESVDQESP----PTTSQ-----------GTTTPETAA 1182

  Fly   920 DASMASESDSDSDEPVRR----PKRQSAKDKP------QAGKAQPPGKGRLASSASSTAPAAHPS 974
            ...:.||||.....||..    |.....::.|      ..|.:..|...|..|..|..:|...|:
 Worm  1183 TGGLESESDEPEYPPVPEELVPPPPVLLENFPSTDRFSSGGSSNYPTLSRQGSINSMASPMFSPN 1247

  Fly   975 DD----------------------------------------SEEDEEEEEPSAARAASSKQQQQ 999
            .|                                        ||..|..|.|....|||..::.:
 Worm  1248 SDLSLSGPLTLPRSGPLTMANIRQSPTPDEVVGSLRKRLSQTSESSESSELPPPPSAASKSKRIR 1312

  Fly  1000 QASSLRGSRAGGNRAM-----------SSGAASAKGRDYDLSEI-------------------RS 1034
            :||......|..:..|           ||||..     :|:|..                   |.
 Worm  1313 RASERSIDSASEHHRMMRSPRILTTQHSSGALI-----FDISTTQPTDTSGPIEALSVRKPGRRK 1372

  Fly  1035 ELKGFQPKLLTN-----------------AASNEERKDLA--KKEPSDEPALQDIKKEPKLESSA 1080
            .:....|.|||:                 |.....:|.|.  :|.||..      .::|:.|..|
 Worm  1373 TVFAASPTLLTSGPLTLSSSAPPPPPASPAPPQHAQKTLGRPRKTPSTS------SRKPEEEDEA 1431

  Fly  1081 KS------SSTELSSETESYADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKE 1139
            :.      ..||.:|..:|.|.||..|.|      ||...:.|...|.|....:.:|.:.:...:
 Worm  1432 EQIPTTVVGVTEEASVADSSAKEDLTSED------GSATPQDEKDDSESTTTTDTITPKSIRGGK 1490

  Fly  1140 E-----------PLK-IEPKTEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSS 1192
            .           |:| .:|..:||:...:     .|||.|......|.....::..:|.|.....
 Worm  1491 RRRGGGRFGGSYPVKPAKPGRKPKDPHAE-----EGADEKDPEDQTPTTMTTSTPTRADSFQTQK 1550

  Fly  1193 STTAK----------------YTSVIVEKPLTIGGKKSV----EQHVPKKAELLKKQSGGAGGTA 1237
            :..||                :..:|.|.|     |:.:    |:...:..|:..:       ..
 Worm  1551 NRMAKLMEGKPHDYSFLDLPDFDKIIEEAP-----KEDINILMEERTYELREIFAQ-------CK 1603

  Fly  1238 ASSSAASQESKKFAEPVASLKVEMPA-ACSPSSSSSSSSSFCST 1280
            |..||..:..::..|  |..|.|..| ..|.::::.:|||.|||
 Worm  1604 ADLSALEKRYRQQNE--AKRKAEFAAKTASSAAAAQASSSTCST 1645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 33/320 (10%)
ARID 299..381 CDD:279697 25/82 (30%)
Tudor-knot 692..751 CDD:288553 21/95 (22%)
arid-1NP_001300004.1 ARID 660..740 CDD:279697 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131111740
eggNOG 1 0.900 E1_KOG2744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 1 1.000 T474837
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13964
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.