DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Gm5755

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_488332.3 Gene:Gm5755 MGIID:3646107 Length:1503 Species:Mus musculus

Alignment Length:1840 Identity:370/1841 (20%)
Similarity:585/1841 (32%) Gaps:531/1841 (29%)


  Fly   368 NLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRS-----------KGRSLVRANSVASPKPMET 421
            |.||      |:||....||  ...:.:.|.|..|           :|||:.:...|.:....| 
Mouse    20 NFVK------LKPYDRRARK--ARSVSSPRKSTESRSLQPTLQRRLRGRSVKKRRLVENGYSKE- 75

  Fly   422 MKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPK 486
             ||.|..|         :.||..:        |||..|.      |.||:...|.:||...:...
Mouse    76 -KTYTGEK---------IPSTEKN--------SSTEKRC------SLAEKYHTTVKSSSAEKLLL 116

  Fly   487 KQRKGSAASSQQGKVKSLVEKYE--EKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLS 549
            .::...|..|...|.:|..||:.  ||....|.:|||....|....|..:...:.....|....|
Mouse   117 VEKHPYADKSLTRKKRSSAEKHSPTEKGRMTQKSSSGGRRHSETHQSGKSPHFSEECQITEKRHS 181

  Fly   550 SATSGGSATIATTAMNKDAESDL--PLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSA 612
            |...|.|        :||..:|.  |:.|           |.|.||..:...|.....|..|.:.
Mouse   182 SVKHGSS--------DKDHPADRGHPINK-----------RRSSEKRQSTEKGQLTGRSPYAPAN 227

  Fly   613 EMQRSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKK 677
            |..|          |...|..|....:|.:....:.....:...:.|.....:.:.|...|....
Mouse   228 ERGR----------PTKKGQPTEKGLSTKKGPDTENRHPAKKGYSAKTLSSAERDSQIERGSATG 282

  Fly   678 EKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRY 742
            .::|.||    |.:.|                                ||.|             
Mouse   283 SRLSTEK----DCLSG--------------------------------RGWP------------- 298

  Fly   743 DEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGG------GGGGGGGGGGSLLVQGS 801
               ..:..:||   ||..:|     :|.|..|:..|.....|      .|....|.....:.:.|
Mouse   299 ---AKKSHLAE---KGHSEK-----SSCALRGTSAGKDRSAGRVHSNTRGPAEEGHPVKCICESS 352

  Fly   802 QPPGVSDKQPGKDGCSKMSP-------------SSGNSTGPGAPSLSGSLGGASSTPSL-LSTVV 852
            .|....| ||.:...:|..|             |:|.|.|.|:|:   .:..|....|: :.:.:
Mouse   353 VPSAGKD-QPARSRSNKSIPREESRPVENEICSSTGPSEGRGSPN---KIRRAEKGHSVKIGSSM 413

  Fly   853 KTPPTGGAKR--GRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPT-RVVPGTTT 914
            ...|:.|..|  ||||    |.:|.     .|...|:....:|..:.....|:||. |..||.. 
Mouse   414 SRRPSAGKDRSGGRGR----PIKSG-----CAEESRSVKGGSSASRGSSTGKERPVRRGRPGKI- 468

  Fly   915 PRRVSDASMASESDSDSDEPVRRPKRQSAKDKP-QAGKAQPPGKGRLASSASSTAPAAHPSDDSE 978
             ||..:........|.|..|.....|...:..| ::|.|:........||.|.:.|..       
Mouse   469 -RRADNGPSVENGSSTSRRPSAGKDRSGGQGCPNKSGHAEESWSVEGGSSTSRSPPTG------- 525

  Fly   979 EDEEEEEPSAARAASSKQQQQQASSLRGS-------RAGGNRAMSSGAASAKGRDYDLSEIRSEL 1036
                :|.|.....::|:...:|..|::..       ..|.:|:...|..:.:|.    :|....:
Mouse   526 ----KERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGVRGGPNKRGS----AEEDHSV 582

  Fly  1037 KGFQPKLLTNAASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTE--LSSETESYADEDS 1099
            ||        ::|......:.|    |.||        |...|.||..||  .|.:..|||.   
Mouse   583 KG--------SSSTSRGSSVGK----DHPA--------KRSRSTKSGPTEEGCSVKNGSYAS--- 624

  Fly  1100 QSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETKSKPFLSGA 1164
                     :|:.|| |:.:......|     ||..|.....:|....|.......|.:|...| 
Mouse   625 ---------RGTYAG-KDRSGGRGCPH-----KRGPAEDSHSVKGSRSTSRGSSTGKERPVRRG- 673

  Fly  1165 DIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVEQHVPKKAELLKKQ 1229
                       |.|....|....|..:.|:|::..|.        |..:|..|..|.|:...::.
Mouse   674 -----------RLGKIRRADNGRSVENGSSTSRRPSA--------GKDRSGGQGYPNKSGHAEES 719

  Fly  1230 SGGAGGTAASSSAASQESKKFAEPVASLKVEMPAACSPSSSSSSSSSFCSTGSAVSSSSATRSLP 1294
            ....||::.|.          |.|...::   |.....|:|.|.:..:||....:.::|.|....
Mouse   720 WSVEGGSSISR----------APPTGKVR---PVRRCVSNSRSPAEQWCSIKCGICATSVTSVGK 771

  Fly  1295 DMSKLEISSGTVPGATPGAAALQPSNVAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYE 1359
            |.|          |...|      .|...::..|...:...|:|.|::.|....:|:...|.:..
Mouse   772 DRS----------GERGG------PNKRGLAEEGQTVKGSSSTSKGSSVGKDRPVRRGRPSKIRR 820

  Fly  1360 FKDTEPFEFEKRISPMASVGGTVAAAATAAGAMAAAGAASVITTMVPTPGASGS-----GVAASA 1419
            ..:....|           .|:......:||...:.|..        .|..||.     .|...:
Mouse   821 ADNVHLVE-----------NGSSTTRRPSAGKDRSGGQG--------CPNKSGHAENSWSVECGS 866

  Fly  1420 STSAPVVVG---------SAARKQALKASAIQ-HILEHQSPAAGRERGGYGG------------- 1461
            |||.....|         |.:|..|.:..:|: .|.....|:.|::|.|..|             
Mouse   867 STSRAPCTGKERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGERGGPNKRGPAEEGHS 931

  Fly  1462 --MTSSISLLTAPKLKKRGSPLKEAALCMEKAKTYKLDKDQVQQPVEQKTQQLIQPTLGPVESYG 1524
              .:||.|         |||.:.:|. .:.:.:..|:.:......||..:....:|:.|...|.|
Mouse   932 VKGSSSTS---------RGSSVGKAH-PVRRGRPSKIRRAHNVHSVENGSSTSRRPSAGKDRSGG 986

  Fly  1525 AGSPEAMSNLSTPTTSSGHAQLSASSTYSQLTPHHATPFDALRKSPSFNLNITALNEELAQTVQE 1589
            .|.|          ..||||:.|.|                                  .:....
Mouse   987 QGCP----------NKSGHAEESWS----------------------------------VEGGSS 1007

  Fly  1590 TTRALTDALQPPS---TPVPPTVSASGSTPTAVTPV-----ITAMPT-----AGTAGLSCPSTPP 1641
            |:||      ||:   .||...||.|.|.......:     .|::|:     :|..|......|.
Mouse  1008 TSRA------PPTGKERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGERGGPNKRGPA 1066

  Fly  1642 TGANPVLASPKLSTPPQAINASKQPPASHIVGSPFIETRNVFELSTSNEGSGYSSGES--KDNKF 1704
            ...:.|..|...|..|   :..|:.|...  |.|..::|:..:..::.:|:....|.|  ||:..
Mouse  1067 EEGHSVKGSSSTSRGP---SLGKEHPIGR--GRPPKKSRHEKDSCSAEKGNHADKGTSAGKDHPT 1126

  Fly  1705 EKLENVKILLAGAVGPFDLDAGSYEQKTSSIADKVLKAISQKKEEVENNKG--KPPVEPAAAAKT 1767
            .:.:..|.......|.. ::.||..::..|:           |::....:|  :||.:...|.: 
Mouse  1127 GRGQPRKKSHPAEAGHL-VEKGSSAERGPSV-----------KKDPHTGRGRLRPPKKSHPAER- 1178

  Fly  1768 PGREDVVPSPTAKLDLCSSAIKLDTLKLLSEPLKIQTG-PLL-GELYRPGPATSSPETKSILESS 1830
                    ..:|.:.:|             .|.|.|.. |:: .:..|......|.|...:.:.|
Mouse  1179 --------HLSASMKVC-------------PPKKHQPAKPVVCVKRVRSAERVHSMERGHLAKKS 1222

  Fly  1831 LPAKNSELSETIQKLECAIQQRKTPVGGALSLASSTAGTPPTAHTPNSTATAGAGFSDESMDSTD 1895
            .|||....:|     |.::.:|      ..|.....:|  ..||:...:.||.....:.:|.|  
Mouse  1223 CPAKRQLSAE-----EGSMAER------GCSFEKDLSG--ERAHSSQRSCTAEERSEEGNMHS-- 1272

  Fly  1896 SEQRLVIEDVIAEEHTTTTTTG---EQKSPGSQQEEGQTNT--ATMATAVTAETEGTSSSTPTPP 1955
                       .|:...:..||   |:.|.||..:..:.|.  :.....:.:||... :..|...
Mouse  1273 -----------VEKGHPSMETGFREEKSSSGSMSKATEPNNLQSPPENRIGSETNQV-AQVPHRN 1325

  Fly  1956 VPAPVKLELGAKAMPGIQAPIPLK--PAEGSSFAGKLTGVVQPPP-------LAK---LQQQEEL 2008
            :||.||:::|.:    ::.|..||  ..|......|...:.|.|.       ||:   ..:.::|
Mouse  1326 MPATVKIKMGVE----LKLPDELKFRLVEDWDLVNKQNQLFQLPAEKTVDTILAEYVTFVKSQDL 1386

  Fly  2009 GQAQGQSKSISSFG------------------------IPIVLPEIPASVVVATPAL--MVASAA 2047
            |..:..|.....||                        |.:..|.||.|.|...|.|  :.....
Mouse  1387 GDNREYSVDEVVFGIREYFNKMLGTQLLCKFEKPQYAEIHLAYPGIPMSQVYGAPHLLRLFVKIG 1451

  Fly  2048 TVMRHSPGSTPNSQAPVLIS 2067
            |.:.|||   .|.|:.:|:|
Mouse  1452 TALAHSP---LNRQSLLLVS 1468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 5/13 (38%)
Tudor-knot 692..751 CDD:288553 4/59 (7%)
Gm5755XP_488332.3 MRG 1312..1487 CDD:283390 38/166 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.