DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and osa

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster

Alignment Length:2387 Identity:447/2388 (19%)
Similarity:662/2388 (28%) Gaps:849/2388 (36%)


  Fly   424 TETISKLAQ------PNQTNVVASTSSSAAAASVAASST-------------------------- 456
            |.|::.|.|      |.|.....:.....||||.||::.                          
  Fly   212 TPTLNSLLQSSNPPPPPQHRYANTYDPQQAAASAAAAAAAQQQQAGGPPPPGHGPPPPQHQPSPY 276

  Fly   457 ---------PARAVS----TASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLVEKY 508
                     |.|..|    .:.|.......|||.......|...|..||..||.|.:.:...::.
  Fly   277 GGQQGGWAPPPRPYSPQLGPSQQYRTPPPTNTSRGQSPYPPAHGQNSGSYPSSPQQQQQQQQQQQ 341

  Fly   509 EE--------------KSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATS------ 553
            ::              ..|..|.....|...|..|......||.....:..:|..:|.|      
  Fly   342 QQAGQQPGGPVPGGPPPGTGQQPPQQNTPPTSQYSPYPQRYPTPPGLPAGGSNHRTAYSTHQYPE 406

  Fly   554 ------GGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRH--SMEKE----TNISSGSSASAS 606
                  |||        :....|..||        ..||..|  .::::    .::|:|....:|
  Fly   407 PNRPWPGGS--------SPSPGSGHPL--------PPASPHHVPPLQQQPPPPPHVSAGGPPPSS 455

  Fly   607 SKANSAEMQRSRDASPSVAAP-------------PSAGASTSGAAATAQTASNKKEKHQRSKQAD 658
            |..::.    |....||.|:|             .|:|.:.||..:......|.::..       
  Fly   456 SPGHAP----SPSPQPSQASPSPHQELIGQNSNDSSSGGAHSGMGSGPPGTPNPQQVM------- 509

  Fly   659 KEKDKDKEEKQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEIS 723
                :.......|||.|.......:.                  |....|:|:.|:....:.:..
  Fly   510 ----RPTPSPTGSSGSRSMSPAVAQN------------------HPISRPASNQSSSGGPMQQPP 552

  Fly   724 VQRGVPMYLVHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGG---------- 778
            |..|.|..:..:.|                 :..|..|:.::....::||.|...          
  Fly   553 VGAGGPPPMPPHPG-----------------MPGGPPQQQQSQQQQASNSASSASNSPQQTPPPA 600

  Fly   779 ------------------GGGGGG--------GGGGGGGGGGSLLVQGSQPPGVSDKQPGKDGCS 817
                              |..|||        ||...||.|.|...||..|.......||.....
  Fly   601 PPPNQGMNNMATPPPPPQGAAGGGYPMPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYPPR 665

  Fly   818 KMSPSSGNSTGPGAPSLS-GSLGGASSTPSLLSTVVKTPPTGGAKRGRGRSDSMP---------- 871
            ...|....:|||..|..| ...|||:|.||            ||:.|......||          
  Fly   666 PQYPPGAYATGPPPPPTSQAGAGGANSMPS------------GAQAGGYPGRGMPNHTGQYPPYQ 718

  Fly   872 -----PRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVSDASMASESDSDS 931
                 |:.|.|..         :|..:......|.|..|...|.|...|          ...|.|
  Fly   719 WVPPSPQQTVPGG---------APGGAMVGNHVQGKGTPPPPVVGGPPP----------PQGSGS 764

  Fly   932 DEPVRRPKRQSAKDKPQAGKAQPP------GKGRLASSASSTAPAAH----PSDDSEEDEEEEEP 986
            ..|:...|:.........|...||      |.|.............|    |...:........|
  Fly   765 PRPLNYLKQHLQHKGGYGGSPTPPQGPQGYGNGPTGMHPGMPMGPPHHMGPPHGPTNMGPPTSTP 829

  Fly   987 SAARAASSKQQQQQASSLRGSRAGG-------NRAMSSGAASAKGRDYDLSEIRSELKG------ 1038
            ..::.....|.|.|.:| .|..:||       |...|||...|.|.....|.:.:...|      
  Fly   830 PQSQMLQGGQPQGQGAS-GGPESGGPEHISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEV 893

  Fly  1039 FQPKLLTN--AASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTELSSETESYADEDSQS 1101
            .|...|:|  |||.|:.:....|...::|                        .::|:....|.|
  Fly   894 SQQSTLSNASAASGEDPQCTTPKSRKNDP------------------------YSQSHLAPPSTS 934

  Fly  1102 SDYRKQLKGSGAGKK----------EPTASPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETK 1156
            ........|.|.|::          .|..||...:|.|       |.:||.: ...|..|:.::.
  Fly   935 PHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVP-------VPQEPFR-STITTTKKSDSL 991

  Fly  1157 SKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTI----------GG 1211
            .|.:....:        |.|.|.....:|......:..||..|  |.::||.:          ||
  Fly   992 CKLYEMDDN--------PDRRGWLDKLRAFMEERRTPITACPT--ISKQPLDLYRLYIYVKERGG 1046

  Fly  1212 KKSVEQHVPKKAELLK----KQSGGAGGTAASSSAASQESKKFAE-----------------PV- 1254
                      ..|:.|    |...|..|..||||||....|.:.:                 |: 
  Fly  1047 ----------FVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPII 1101

  Fly  1255 -----ASLKVEMPAACSPS--------------SSSSSSSSF-CSTGSAVSSS-SATRSLPDMSK 1298
                 .|.|....||..||              .||:|..|| ...|||.::: ......|..|.
  Fly  1102 QQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDSFPAPPGSAPNAAIDGYPGYPGGSP 1166

  Fly  1299 LEISSGTVPG-ATPGAAALQPS-NVAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEFK 1361
            ..::||..|. ||.|.....|| |..|....|||        ...|||..||:            
  Fly  1167 YPVASGPQPDYATAGQMQRPPSQNNPQTPHPGAA--------AAVAAGDNISV------------ 1211

  Fly  1362 DTEPFEFEKRISPMASVGGTVAAAATAAGAMAAAGAASVITTMVPTPGASGSGVAASASTSAPVV 1426
             :.|||     .|:|:.||..:......|.....||||        .||...|.........|..
  Fly  1212 -SNPFE-----DPIAAGGGPGSGTGPGPGQGPGPGAAS--------GGAGAVGAVGGGPQPHPPP 1262

  Fly  1427 VGS--AARKQALKASAIQHILEHQSPAAGRERGGYGGMTSSISLLTAPKLKKRGSPLKEAALCME 1489
            ..|  .|.:||......|| .:||.|       |..|        ..|..:::|           
  Fly  1263 PHSPHTAAQQAAGQHQQQH-PQHQHP-------GLPG--------PPPPQQQQG----------- 1300

  Fly  1490 KAKTYKLDKDQVQQP-------------------VEQKTQQLIQPTLG-PVESYGAGSPEAMSNL 1534
                     .|.|||                   |....||.::|..| |....|:|.|..:|..
  Fly  1301 ---------QQGQQPPPSVGGGPPPAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRT 1356

  Fly  1535 ---STPTTSSGHAQLSASSTYSQLTPHHATPFDALRKSPSFNLNITALNEELAQTVQETTRALTD 1596
               ..|:....:.|..:|..|                                           :
  Fly  1357 PGSPYPSQPGAYGQYGSSDQY-------------------------------------------N 1378

  Fly  1597 ALQPPSTPVPPTVSASGSTPTAVTPVITAM-PTAGTAGLSCPSTPPTGAN---PVLASPKLSTPP 1657
            |..||..|.       |..|....|....| |..|..|    ..||||||   |..:.|....||
  Fly  1379 ATGPPGQPF-------GQGPGQYPPQNRNMYPPYGPEG----EAPPTGANQYGPYGSRPYSQPPP 1432

  Fly  1658 QAINASKQPPASHIVGSPFIETRNVFELSTSNEGSGYSSGESKDNKFEKLENVKILLAGAVGPFD 1722
                ...|||...:.|.|                                               
  Fly  1433 ----GGPQPPTQTVAGGP----------------------------------------------- 1446

  Fly  1723 LDAGSYEQKTSSIADKVLKAISQKKEEVENNKGKPPVEPAAAAKTPGREDVVPSPTAKLDLCSSA 1787
             .||                            |.|...|::|..| ||                 
  Fly  1447 -PAG----------------------------GAPGAPPSSAYPT-GR----------------- 1464

  Fly  1788 IKLDTLKLLSEPLKIQTGPLLGELYRPGPATSSPETK---SILESSLPAKNSELSETIQKLECAI 1849
                              |...:.|:| |...||:.:   ..::.|.|.........|.....:.
  Fly  1465 ------------------PSQQDYYQP-PPDQSPQPRRHPDFIKDSQPYPGYNARPQIYGAWQSG 1510

  Fly  1850 QQRKTPVGGALSLASSTAGTPPTAHTPNSTATAG------AGFSDESMDSTDSEQRLVIEDVIAE 1908
            .|:..|...:.....:..|.||....|...|..|      ||.:.                  .:
  Fly  1511 TQQYRPQYPSSPAPQNWGGAPPRGAAPPPGAPHGPPIQQPAGVAQ------------------WD 1557

  Fly  1909 EHTTTTTTGEQKSPGSQQEEGQTNTATMATAVTAETEGTSSSTPTPPVPAPVKLELGAKAMPGIQ 1973
            :|......|....|..||:..|.........|.    |.....|....|...::..|..|..||.
  Fly  1558 QHRYPPQQGPPPPPQQQQQPQQQQQQPPYQQVA----GPPGQQPPQAPPQWAQMNPGQTAQSGIA 1618

  Fly  1974 AP-IPLKPAEGSSFAGKLTGVVQPPPLAKLQQQEELGQAQGQSKSISSFGIPIVLPEIPASVVVA 2037
            .| .||:|..|.....::.|:    |..:.|.|::.|..|...:..|..|:|             
  Fly  1619 PPGSPLRPPSGPGQQNRMPGM----PAQQQQSQQQGGVPQPPPQQASHGGVP------------- 1666

  Fly  2038 TPALMVASAATVMRHSPGSTPNSQAPVLISPKTFLTAPKVGEVGGLLLKAYT-------GVSGAV 2095
                           |||                  .|:||. ||::...|.       ||...|
  Fly  1667 ---------------SPG------------------LPQVGP-GGMVKPPYAMPPPPSQGVGQQV 1697

  Fly  2096 GAAPAGSVIASAGGGGTPTVISNFPQQQQQASVLQASSEMPANYVLDAEMAEPSNSSAPVVARPF 2160
            |..|.|.:::..........:...|.|||..|...........:....:|  |.|.:||....|.
  Fly  1698 GQGPPGGMMSQKPPPMPGQAMQQQPLQQQPPSHQHPHPHQHPQHQHPHQM--PPNQTAPGGYGPP 1760

  Fly  2161 VMHAVGKELFNVVAPAASSPLISDPHN--ESI--------NLLCEETIPGSP-----APNYGGTD 2210
            .|...|.:|       ....||. ||:  ||.        .|:..:..|..|     |...|...
  Fly  1761 GMPGGGAQL-------VKKELIF-PHDSVESTTPVLYRRKRLMKADVCPVDPWRIFMAMRSGLLT 1817

  Fly  2211 QLPTAV---------NSALAIVGITPLPPDTPPPVPVAAIQQQQQHQLQSGQQQQAAKTGEVNPS 2266
            :...|:         :|.:...||:.|     |.:....::..|::..:...:::          
  Fly  1818 ECTWALDVLNVLLFDDSTVQFFGISNL-----PGLLTLLLEHFQKNLAEMFDERE---------- 1867

  Fly  2267 GPNSSPDSASQDESGEEAKKNAGLEHEDSTGLGALNKRKRNRKPLPMSAQTAAAVAAQLQSLGKR 2331
              |....:...:::.::|         ||..:.....|...|:|     :...::::.     .|
  Fly  1868 --NEEQSALLAEDADDDA---------DSGTVMCEKLRTSGRQP-----RCVRSISSY-----NR 1911

  Fly  2332 RRQVSGMRNQKTTTTAAGSDTDDNSDNIAPNAGQQQQQPRQSARQHMM----------------- 2379
            ||....|..........|||::|..:.|  :.||.:.||....|..::                 
  Fly  1912 RRHYENMDRSGKDGAGNGSDSEDADEGI--DLGQVRVQPNPEERSLLLSFTPNYTMVTRKGVPVR 1974

  Fly  2380 ---PQSNAQQQQQQQLLQQQQTQLPQGIQSTNSSGVRPCPYNFLVELDPALSSDECITILRKQIQ 2441
               .:::....::|:.......:|.:.::...|..   ..|.| .|.||.   |..|.:.:.:|.
  Fly  1975 IQPAENDIFVDERQKAWDIDTNRLYEQLEPVGSDA---WTYGF-TEPDPL---DGIIDVFKSEIV 2032

  Fly  2442 DL---RKAYNTIKG----ELAVIDRRRKKLRRREREKKQQQLQSQQQ 2481
            ::   |...:..||    ||| ...|:.:::..|...::|....:::
  Fly  2033 NIPFARYIRSDKKGRKRTELA-SSSRKPEIKTEENSTEEQTFNKKRR 2078

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 8/59 (14%)
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 24/103 (23%)
DUF3518 2191..2451 CDD:288854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
11.030

Return to query results.
Submit another query.