DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and MRG15

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001262588.1 Gene:MRG15 FlyBaseID:FBgn0027378 Length:429 Species:Drosophila melanogaster

Alignment Length:484 Identity:103/485 (21%)
Similarity:169/485 (35%) Gaps:151/485 (31%)


  Fly   673 GKRKKEKISVEKIDTGD-----FVVGIGDKLKVNYHEKKSPSSHGS-TYEAKVIEISVQRGVPMY 731
            |:.|..|  ||...||.     ||.|           ::....||. .|||||::.........|
  Fly     2 GEVKPAK--VENYSTGTDANTLFVDG-----------ERVLCFHGPLIYEAKVLKTKPDATPVEY 53

  Fly   732 LVHYTGWNNRYDEWVPRERIA---ENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGG 793
            .:||.||:..:|||||..|:.   ::..|..::..|.....|......|                
  Fly    54 YIHYAGWSKNWDEWVPENRVLKYNDDNVKRRQELARQCGERSKKDNKKG---------------- 102

  Fly   794 GSLLVQGSQPPGVSDKQ--------PGKDGCSKMSPSSG---NSTGPGAPSLSGSLGGASSTPSL 847
              :.:.||......::.        |.||..:..|.:|.   .|.|||:.|.:||.|..::..:.
  Fly   103 --VYIPGSAKAKKMEQMRNESRASTPSKDSNTSQSTASSTPTTSAGPGSKSEAGSTGTTTTNSTA 165

  Fly   848 LSTVVKTPPTGGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGT 912
            .||..:                            ||...|:|              .|:...|||
  Fly   166 NSTTSR----------------------------AHRKSTQS--------------TPSTARPGT 188

  Fly   913 TTPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQ------AGKAQPPGKGRLASSASSTAPAA 971
            .:.::...|  |:|: ::.:.||...|::.::.:|.      |.|..||   ....|..:|.|| 
  Fly   189 PSDKKEDPA--AAET-TEEEGPVAPKKKRMSEQRPSLTGSDVAEKPLPP---TTTPSTPTTEPA- 246

  Fly   972 HPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGRDYDLSEIRSEL 1036
             |..:|||         |.||..:.:.:....|:........|:.        |::.|.|:    
  Fly   247 -PCVESEE---------AYAAKVEVKIKIPDELKHYLTDDWYAVV--------REHKLLEL---- 289

  Fly  1037 KGFQPKLLTNAASNEE----RKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTELSSETESYADE 1097
                |..:|....:|:    :|.:.....|.|.|:.|:     |:...:..:..|.|:. .|..|
  Fly   290 ----PAKVTVQQISEQYLAHKKSVKSTSASKEVAINDV-----LDGIVEYFNVMLGSQL-LYKFE 344

  Fly  1098 DSQSSDYRKQLKGSGAGKKEPTASPSKLH 1126
            .:|.:|..         :|.|....|:|:
  Fly   345 RTQYADVM---------QKHPDTPLSELY 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 19/60 (32%)
MRG15NP_001262588.1 Tudor-knot 22..75 CDD:288553 21/64 (33%)
MRG 249..415 CDD:283390 30/157 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.