DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and CG42337

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001246858.1 Gene:CG42337 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster

Alignment Length:646 Identity:127/647 (20%)
Similarity:196/647 (30%) Gaps:199/647 (31%)


  Fly  1869 TPPTAHTP--------NSTATAGAGFSDESMDS------------------------TDSEQRLV 1901
            ||..:|.|        ....|.|.|:...|..|                        |.:.|:::
  Fly    23 TPTMSHYPPQPYRSGYTGYHTYGYGYGSSSSASYMPNYYRYAPYASPHYSQHHQGMFTPAGQQII 87

  Fly  1902 IEDVIAEEHTTTTTTGEQKSPGSQQEEGQTNTATMATAVTAETEGTSSSTPTPPVPAPVKLELGA 1966
            ...|:   |........|:.|..||...|              :......|.||:|........:
  Fly    88 PSSVL---HYPPRPHPYQQLPQQQQPHPQ--------------QSQPGYEPPPPLPYSSSASYQS 135

  Fly  1967 KAMPGIQAPIPLKPAEGSSFAGKLTGVVQPP----PLAK-------LQQQEELGQAQGQSKSISS 2020
            :.......|.|.....|.|........|.||    ||..       |.||:.|.|.|.|...:. 
  Fly   136 RGFGAFAGPTPHYAPPGRSSTPAPNRTVLPPSYLEPLRSYSAEQQHLSQQQHLSQQQLQHHPLP- 199

  Fly  2021 FGIP-IVLPEIPASVVVATPALMVASAATVMRHSPGSTPNSQAPVLISPKTFLTAPKVGEVGGLL 2084
             |.| :..|::....|..:||..:.:                :|.:||.                
  Fly   200 -GTPKLEDPDVEVEAVAESPAQRLTT----------------SPPMISA---------------- 231

  Fly  2085 LKAYTGVSGAVGAAPAGSVIASAGGGGTPTVISNFPQQQQQASVLQASSEMPANYVLDAEMAEPS 2149
                ||...  |.:...:...|.....||.....:|....    ::::|.:|.:...||...|..
  Fly   232 ----TGTDS--GISNCSTRARSDSSQSTPVYSGEYPVNMS----VESASCVPYHCPADARDYEEE 286

  Fly  2150 NSSAPVVARPFVMHAVGKELFNVVAP-------AASSPLISD------PHNESINLLCEET---- 2197
            ....||.|          |:.....|       :|:||:.:|      |.:..:....|..    
  Fly   287 EHQPPVTA----------EVRRADTPLDITDDISATSPVAADEVKPTAPTSSQVAKSAETNLQPD 341

  Fly  2198 ------IPGSP--------------APNYGGTDQLPTAVN--SALAIVGITPLPPDTP------- 2233
                  :|.:|              .|.:....|.|...|  .........|.|.::|       
  Fly   342 SAASLDVPTTPQDTSGDPITEAADERPEHARQQQHPVTNNWSPTTRRPRTPPAPQNSPIGFGQNA 406

  Fly  2234 --PPVPVAAIQQQQQHQLQSGQQQQAAKTGEVN---PSGPNSS-----------PDSASQDESGE 2282
              ||.....:|||||.|||..||||..:.|.:.   .||.|.|           |...|:.:|  
  Fly   407 SVPPALAHLLQQQQQQQLQLQQQQQQQQVGNLKRCATSGKNRSSHNRIIECDLIPSKKSKRKS-- 469

  Fly  2283 EAKKNAGLEHEDSTGLGALNKRK-RNRKPLPMSAQTAAAVAAQLQSLGKRRRQVSGMRNQKTTTT 2346
             .||.|| |.|:...:..:.:.: |:.||||...|  |..:.::....:|..|......::....
  Fly   470 -VKKQAG-EIENMEAVEPIVREQIRDIKPLPGFLQ--AFGSTEIGRFSERFLQTPESLVERLAEE 530

  Fly  2347 AAGSDTDDNSDNIAPN------AGQQQQQPRQSARQHMMPQSNAQQQQQQQLLQQQQTQLP 2401
            .|||         |||      ||...:.|..:...:...:...|....:..::....::|
  Fly   531 YAGS---------APNNCPSHSAGGYIESPAMATHNYYPYEEQNQGGYPRNRMRDYGYEIP 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553
CG42337NP_001246858.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.