DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and msl-3

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_523951.1 Gene:msl-3 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster

Alignment Length:223 Identity:46/224 (21%)
Similarity:76/224 (34%) Gaps:69/224 (31%)


  Fly   928 DSDSDEPVRRPKRQSAK-------------DKPQAGKAQPPGKGRLASSASSTAPAAHPSDDSEE 979
            |::.:..::|...::||             |||.|.|.      |...:|....|...|.|....
  Fly    75 DTEENRQLQRELAEAAKLQIRGDYSYKGTPDKPSAKKK------RGGKAAHVEEPIVVPMDTGHL 133

  Fly   980 DEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMS--SGAASAKGRDYDLSEIRSELKGFQPK 1042
            :.|.|.....|||.::.:         ..:||.|...  ||....||.           :|.|.:
  Fly   134 EAEHEMAPTPRAAGNRTR---------DNSGGKRKEKPPSGDGRLKGN-----------RGRQTE 178

  Fly  1043 LLTNAASN----------EER------KDLAKKEPSDEPALQDIKKEPKL----------ESSAK 1081
            ...|.|.|          |:|      :.|.:....|...::.:.|:..|          |:..|
  Fly   179 TFYNNAINDVSVYNHVPQEDRIMMRVSERLRELIEYDRNMIKVLGKQHALPARVPIVTIMENFVK 243

  Fly  1082 SSSTEL--SSETESYADEDSQSSDYRKQ 1107
            ..:.||  |.:.:|....::||.:.|.:
  Fly   244 QQAVELAISIKQDSSRARNTQSRNARME 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553
msl-3NP_523951.1 MRG 196..486 CDD:283390 15/77 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.