DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid3b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_008764545.1 Gene:Arid3b RGDID:1306335 Length:573 Species:Rattus norvegicus

Alignment Length:616 Identity:136/617 (22%)
Similarity:232/617 (38%) Gaps:161/617 (26%)


  Fly   113 KSGRHFNESETL---------DQLPLTHPEHFGNPVVG--GR--------RGRRRGHLNEDSSE- 157
            |.|.|..|::.|         ..|.:|.....|:||:|  ||        |...:.::|.:..| 
  Rat    23 KQGSHTREAQFLYAPKLGTQPALLSVTPGRPSGSPVLGPLGRVLPATPAARVSEQSNVNSEPEEE 87

  Fly   158 ------DDDESDAKEVVNEKEENIGKVVCVETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYL 216
                  :|.:.|..||..::.:...|...::..::::.:.....:|:.||...            
  Rat    88 EGGLEDEDGDDDVTEVAEKEAQAASKYFHMQKATRQEPRAAPMSSLLPAPGLP------------ 140

  Fly   217 VRSFKDGRYYTVPKKEATEFTREVASK--QDVPAVQAALEFLDSSVLPAHWDRDSLFGLTN---- 275
                        |:.:..|...:.|||  ..||........||..:.    .|.:|.|..|    
  Rat   141 ------------PQGQTKEDHTKDASKAPPSVPTAGQPSWNLDEQLK----QRKTLLGQKNGALA 189

  Fly   276 ISSDDEG----EIDSDSS-----DDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRL 331
            .|.|.:|    ||..|.:     |.:|  |:..|:..|:.:|..||||:|::|.:..:.:|||.|
  Rat   190 WSDDADGGRGREISRDFAKLYELDGDP--ERKEFLDDLFIFMQKRGTPINRIPIMAKQILDLYML 252

  Fly   332 FRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGC-SMLMT 395
            ::.|.::||...:.::..|:.|...|.......|....::..|.|:|..|....:.|.. :.|..
  Rat   253 YKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLYAYECEKKALSSPAELQA 317

  Fly   396 SRNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPA-- 458
            :.:.||.:||....::|:....|.                  ..|:.:::|||||.|::..||  
  Rat   318 AIDGNRREGRRPSYSSSLFGYSPA------------------AAAAAAAAAAAASAASAGAPALL 364

  Fly   459 --RAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSA-------------------ASSQQGKVK 502
              ..:..:.......|| |:.||..:.|....|||..                   |.::.|.::
  Rat   365 SPPKIRFSILGLGSSSG-TNTSSPRIPPASTLRKGDGVPVPVPNRLAVSGPLAGQQAGNRTGTLE 428

  Fly   503 SLVEKY------EEKSTAVQATSSGTVAGS---GASASAAAMP------------TTSAAASTAT 546
            .|.|:.      |:|::.:.......|..:   ...:.|..:|            .||||   |.
  Rat   429 QLRERLESGEPPEKKASRLSEEEQRLVQQAFQRNLFSMARQLPMKIRINGREDRAETSAA---AL 490

  Fly   547 NLSSATSGGSATIATTAMNKDAESD------LPLAKIKAAAVAAASTRHSMEKETNISSGSSASA 605
            ||:::..|        ::|...:.|      :..|:.....:.|.|...|:        |||||:
  Rat   491 NLTTSNIG--------SINMSVDIDGITYTGVLFAQKPVVHLIAGSAPQSI--------GSSASS 539

  Fly   606 SSKANSAEMQRSRDASP-SVAAPPSAGASTS 635
            ||.::|:........|| |....|||..|||
  Rat   540 SSSSSSSSSSSHCSPSPTSSRGTPSAEPSTS 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 13/93 (14%)
ARID 299..381 CDD:279697 23/82 (28%)
Tudor-knot 692..751 CDD:288553
Arid3bXP_008764545.1 BRIGHT 216..305 CDD:128777 26/91 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.