DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and zgc:77151

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_991128.2 Gene:zgc:77151 ZFINID:ZDB-GENE-030131-9097 Length:856 Species:Danio rerio

Alignment Length:626 Identity:113/627 (18%)
Similarity:197/627 (31%) Gaps:250/627 (40%)


  Fly   264 HWDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDL 328
            |||.:.|                      ||.|:..|:.||:.:|..||:|::|||::..:.:||
Zfish   277 HWDGNWL----------------------PHPEEQLFLDQLFIFMQRRGSPISKVPNLGFKKIDL 319

  Fly   329 YRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHR------- 386
            :.::..|::.|||:||||...||.:...||.:|.:.|.....::.|::.:.||..:.|       
Zfish   320 FLMYSVVKRLGGYDRVTSHRLWKTVYNELGGSPGSTSAATCTRRHYERLMLPYELYIRGENPELI 384

  Fly   387 ---------------------------------------------------KLGCSMLMTSR--- 397
                                                               |....:|:..|   
Zfish   385 KSRATLVSPTSIKKTVRGKGLSSSPKKNAVTNQGLSPDGAVVVRKRGRPPGKRNAKVLVKGRVGR 449

  Fly   398 --------------------------------NSNRSKGRSLVRANSVASPKPME-----TMKTE 425
                                            |....:|.|||.    ::|:|::     .:|.|
Zfish   450 PPLHPKPPLEKPARPHQEIVQPLTFFQELKLTNHPHGQGLSLVS----STPQPLQPILGRDVKVE 510

  Fly   426 TISKLAQPNQTNVVASTSSSAAAASVAASSTP----------ARAVSTASQSAAEESGNTSESSV 480
            |    |:|...:.::......|..|:...|..          ||.....:...|.:..:.:..::
Zfish   511 T----AEPQAPSFLSVPCKVLAGGSLERFSPTKGLCPLDLFRARLGLNGAHEVAPQDSSINHQTL 571

  Fly   481 VVEP----------PKKQRKG--SAASSQQGKVKS--------------LVEKYEEKSTAVQATS 519
            |.:|          |:.|..|  |..|||.|..::              .::..:...|.:.:|.
Zfish   572 VNQPKVSTPETPESPQHQCSGCCSDPSSQNGAPRAPLPPLRIIPLDIGCSLQLRQLMRTRLGSTH 636

  Fly   520 SGTVAGSGASASAAAMPTTS-------AAASTATNLSSATSGGSATIATTAMNKDAESDLPLAKI 577
            ..|.....:...|..:..||       ...|...|||..|           :.|....|:.|..:
Zfish   637 MNTFTKRLSEVLAQDLNKTSQPNGNVPQEQSLPLNLSRRT-----------ITKRPAGDMELTDL 690

  Fly   578 KAAAVAAASTRHSMEKE----------------TNISSGSSASASSKANSAEMQRSRDAS----P 622
            ::..|.:.:.|..||.|                .|....:..|:.|:|.:....|::.||    |
Zfish   691 QSREVQSGTKRPKMEAEDFGVSVKWNGLSFLVPLNQDEPADLSSPSRARALVQDRNKVASALPEP 755

  Fly   623 S-----------VAAPPSAGAS----------------TSGAAATAQTASNKKEKHQRSKQADKE 660
            :           :..|.|.|||                ||..|.|.           :::|....
Zfish   756 TCFSLVPKSDVPLEIPSSIGASPDTLPCIFQLKQGEDKTSTIAVTV-----------KAEQESTS 809

  Fly   661 KDKDKEEKQASSGK----------RKKEKISVEKIDTGDFV 691
            .|.|.|..|.:|..          ::.:.:|..|:.:..|:
Zfish   810 LDPDLEPPQPNSDLYSQCVPTDDIKESDAVSSLKVLSNSFL 850

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 28/82 (34%)
Tudor-knot 692..751 CDD:288553 113/627 (18%)
zgc:77151NP_991128.2 BRIGHT 286..378 CDD:128777 31/92 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.