DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Gm5123

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_285437.4 Gene:Gm5123 MGIID:3643621 Length:1503 Species:Mus musculus

Alignment Length:1837 Identity:362/1838 (20%)
Similarity:582/1838 (32%) Gaps:532/1838 (29%)


  Fly   394 MTSRNSNRSKG-----------------RSLVRANSVASPKPMETMKTETISKLAQP-------- 433
            |:||....|.|                 |...:|.||:||      :..|.|:..||        
Mouse     1 MSSRKKRSSLGGQQFAEGDNFVKLKPHDRRARKARSVSSP------RKSTESRSLQPTLQRRLRG 59

  Fly   434 ---NQTNVVAS------TSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQR 489
               .:..:|.:      |.:.....|...:|:..:..|.|.:.......:::|..::||     :
Mouse    60 RSVKKRRLVENGYSKEKTYTGEKIPSTEKNSSTEKRCSLAEKYHTTVKSSSAEKLLLVE-----K 119

  Fly   490 KGSAASSQQGKVKSLVEKYE--EKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSAT 552
            ...|..|...|.:|..||:.  ||....|.:|||....|....|..:...:.....|....||..
Mouse   120 HPYADKSLTRKKRSSAEKHSPTEKGRMTQKSSSGGRRHSETHQSGKSPHFSEECQITEKRHSSVK 184

  Fly   553 SGGSATIATTAMNKDAESDL--PLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQ 615
            .|.|        :||..:|.  |:.|           |.|.||..:...|.....|..|.:.|..
Mouse   185 HGSS--------DKDHPADRGHPINK-----------RRSSEKRQSTEKGQLTGRSPYAPANERG 230

  Fly   616 RSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKI 680
            |          |...|..|....:|.:....:.....:...:.|.....:.:.|...|.....::
Mouse   231 R----------PTKKGQPTEKGLSTKKGPDTENRHPAKKGYSAKTLSSAERDSQIERGSATGSRL 285

  Fly   681 SVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEW 745
            |.||    |.:.|                                ||.|                
Mouse   286 STEK----DCLSG--------------------------------RGWP---------------- 298

  Fly   746 VPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGG------GGGGGGGGGGSLLVQGSQPP 804
            ..:..:||   ||..:|     :|.|..|:..|.....|      .|....|.....:.:.|.|.
Mouse   299 AKKSHLAE---KGHSEK-----SSCALRGTSAGKDRSAGRVHSNTRGPAEEGHPVKCICESSVPS 355

  Fly   805 GVSDKQPGKDGCSKMSP-------------SSGNSTGPGAPSLSGSLGGASSTPSL-LSTVVKTP 855
            ...| ||.:...:|..|             |:|.|.|.|:|:   .:..|....|: :.:.:...
Mouse   356 AGKD-QPARSRSNKSIPREESRPVENEICSSTGPSEGRGSPN---KIRRAEKGHSVKIGSSMSRR 416

  Fly   856 PTGGAKR--GRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPT-RVVPGTTTPRR 917
            |:.|..|  ||||    |.:|.     .|...|:....:|..:.....|:||. |..||..  ||
Mouse   417 PSAGKDRSGGRGR----PIKSG-----CAEESRSVKGGSSASRGSSTGKERPVRRGRPGKI--RR 470

  Fly   918 VSDASMASESDSDSDEPVRRPKRQSAKDKP-QAGKAQPPGKGRLASSASSTAPAAHPSDDSEEDE 981
            ..:........|.|..|.....|...:..| ::|.|:........||.|.:.|..          
Mouse   471 ADNGPSVENGSSTSRRPSAGKDRSGGQGCPNKSGHAEESWSVEGGSSTSRSPPTG---------- 525

  Fly   982 EEEEPSAARAASSKQQQQQASSLRGS-------RAGGNRAMSSGAASAKGRDYDLSEIRSELKGF 1039
             :|.|.....::|:...:|..|::..       ..|.:|:...|..:.:|.    :|....:|| 
Mouse   526 -KERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGVRGGPNKRGS----AEEDHSVKG- 584

  Fly  1040 QPKLLTNAASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTE--LSSETESYADEDSQSS 1102
                   ::|......:.|    |.||        |...|.||..||  .|.:..|||.      
Mouse   585 -------SSSTSRGSSVGK----DHPA--------KRSRSTKSGPTEEGCSVKNGSYAS------ 624

  Fly  1103 DYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETKSKPFLSGADIK 1167
                  :|:.|| |:.:......|     ||..|.....:|....|.......|.:|...|    
Mouse   625 ------RGTYAG-KDRSGGRGCPH-----KRGPAEDSHSVKGSRSTSRGSSTGKERPVRRG---- 673

  Fly  1168 PTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVEQHVPKKAELLKKQSGG 1232
                    |.|....|....|..:.|:|::..|.        |..:|..|..|.|:...::....
Mouse   674 --------RLGKIRRADNGRSVENGSSTSRRPSA--------GKDRSGGQGYPNKSGHAEESWSV 722

  Fly  1233 AGGTAASSSAASQESKKFAEPVASLKVEMPAACSPSSSSSSSSSFCSTGSAVSSSSATRSLPDMS 1297
            .||::.|.          |.|...::   |.....|:|.|.:..:||....:.::|.|....|.|
Mouse   723 EGGSSISR----------APPTGKVR---PVRRCVSNSRSPAEQWCSIKCGICATSVTSVGKDRS 774

  Fly  1298 KLEISSGTVPGATPGAAALQPSNVAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEFKD 1362
                      |...|      .|...::..|...:...|:|.|::.|....:|:...|.:....:
Mouse   775 ----------GERGG------PNKRGLAEEGQTVKGSSSTSKGSSVGKDRPVRRGRPSKIRRADN 823

  Fly  1363 TEPFEFEKRISPMASVGGTVAAAATAAGAMAAAGAASVITTMVPTPGASGS-----GVAASASTS 1422
            ....|           .|:......:||...:.|..        .|..||.     .|...:|||
Mouse   824 VHLVE-----------NGSSTTRRPSAGKDRSGGQG--------CPNKSGHAENSWSVECGSSTS 869

  Fly  1423 APVVVG---------SAARKQALKASAIQ-HILEHQSPAAGRERGGYGG---------------M 1462
            .....|         |.:|..|.:..:|: .|.....|:.|::|.|..|               .
Mouse   870 RAPCTGKERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGERGGPNKRGPAEEGHSVKG 934

  Fly  1463 TSSISLLTAPKLKKRGSPLKEAALCMEKAKTYKLDKDQVQQPVEQKTQQLIQPTLGPVESYGAGS 1527
            :||.|         |||.:.:|. .:.:.:..|:.:......||..:....:|:.|...|.|.|.
Mouse   935 SSSTS---------RGSSVGKAH-PVRRGRPSKIRRAHNVHSVENGSSTSRRPSAGKDRSGGQGC 989

  Fly  1528 PEAMSNLSTPTTSSGHAQLSASSTYSQLTPHHATPFDALRKSPSFNLNITALNEELAQTVQETTR 1592
            |          ..||||:.|.|                                  .:....|:|
Mouse   990 P----------NKSGHAEESWS----------------------------------VEGGSSTSR 1010

  Fly  1593 ALTDALQPPS---TPVPPTVSASGSTPTAVTPV-----ITAMPT-----AGTAGLSCPSTPPTGA 1644
            |      ||:   .||...||.|.|.......:     .|::|:     :|..|......|....
Mouse  1011 A------PPTGKERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGERGGPNKRGPAEEG 1069

  Fly  1645 NPVLASPKLSTPPQAINASKQPPASHIVGSPFIETRNVFELSTSNEGSGYSSGES--KDNKFEKL 1707
            :.|..|...|..|   :..|:.|...  |.|..::|:..:..::.:|:....|.|  ||:...:.
Mouse  1070 HSVKGSSSTSRGP---SLGKEHPIGR--GRPPKKSRHEKDSCSAEKGNHADKGTSAGKDHPTGRG 1129

  Fly  1708 ENVKILLAGAVGPFDLDAGSYEQKTSSIADKVLKAISQKKEEVENNKG--KPPVEPAAAAKTPGR 1770
            :..|.......|.. ::.||..::..|:           |::....:|  :||.:...|.:    
Mouse  1130 QPRKKSHPAEAGHL-VEKGSSAERGPSV-----------KKDPHTGRGRLRPPKKSHPAER---- 1178

  Fly  1771 EDVVPSPTAKLDLCSSAIKLDTLKLLSEPLKIQTG-PLL-GELYRPGPATSSPETKSILESSLPA 1833
                 ..:|.:.:|             .|.|.|.. |:: .:..|......|.|...:.:.|.||
Mouse  1179 -----HLSASMKVC-------------PPKKHQPAKPVVCVKRVRSAERVHSMERGHLAKKSCPA 1225

  Fly  1834 KNSELSETIQKLECAIQQRKTPVGGALSLASSTAGTPPTAHTPNSTATAGAGFSDESMDSTDSEQ 1898
            |....:|     |.::.:|      ..|.....:|  ..||:...:.||.....:.:|.|     
Mouse  1226 KRQLSAE-----EGSMAER------GCSFEKDLSG--ERAHSSQRSCTAEERSEEGNMHS----- 1272

  Fly  1899 RLVIEDVIAEEHTTTTTTG---EQKSPGSQQEEGQTNT--ATMATAVTAETEGTSSSTPTPPVPA 1958
                    .|:...:..||   |:.|.||..:..:.|.  :.....:.:||... :..|...:||
Mouse  1273 --------VEKGHPSMETGFREEKSSSGSMSKATEPNNLQSPPENRIGSETNQV-AQVPHRNMPA 1328

  Fly  1959 PVKLELGAKAMPGIQAPIPLK--PAEGSSFAGKLTGVVQPPP-------LAK---LQQQEELGQA 2011
            .||:::|.:    ::.|..||  ..|......|...:.|.|.       ||:   ..:.::||..
Mouse  1329 TVKIKMGVE----LKLPDELKFRLVEDWDLVNKQNQLFQLPAEKTVDTILAEYVTFVKSQDLGDN 1389

  Fly  2012 QGQSKSISSFG------------------------IPIVLPEIPASVVVATPAL--MVASAATVM 2050
            :..|.....||                        |.:..|.||.|.|...|.|  :.....|.:
Mouse  1390 REYSVDEVVFGIREYFNKMLGTQLLCKFEKPQYAEIHLAYPGIPMSQVYGAPHLLRLFVKIGTAL 1454

  Fly  2051 RHSPGSTPNSQAPVLIS 2067
            .|||   .|.|:.:|:|
Mouse  1455 AHSP---LNRQSLLLVS 1468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 4/59 (7%)
Gm5123XP_285437.4 MRG 1312..1487 CDD:283390 38/166 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.