DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid4a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_005158686.1 Gene:arid4a ZFINID:ZDB-GENE-050809-105 Length:1332 Species:Danio rerio

Alignment Length:1495 Identity:397/1496 (27%)
Similarity:581/1496 (39%) Gaps:387/1496 (26%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:..|:|..|.|||:|||||:|||||||:..|.|.:||||..|....|.:|.||.:|.|   |||
Zfish     1 MKVADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRMVKVKVVLKGDSTSQVVQDDQVKGP---LRV 62

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            |:.|||:.|: ..|.||.|:|:.|.|.|||||||||..|||||:||||..|||.|||||||||||
Zfish    63 GSTVEVKSPE-GGLSEAVISKLTDASWYTVVFDDGDEKTLRRTSLCLKGERHFAESETLDQLPLT 126

  Fly   131 HPEHFGNPVVGGR--RGRRRGHL-----NEDSSEDDDESDAKEVVNEKEENIGKVVCVETESKKK 188
            :|||||.||:|.:  ||||....     .|.||.:||:.|.:.:   .::.:|||.||::|    
Zfish   127 NPEHFGTPVIGKKTNRGRRSSQAVAEDEKESSSSEDDDDDKRRL---NDDLLGKVACVQSE---- 184

  Fly   189 DKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDV---PAVQ 250
            ..:.|...||::|:....:.:: ||:.|||||.|.:::||.:|:..|...:..||.:.   ...:
Zfish   185 PDDSWLCVLVISPSCNDDLTVK-KDQCLVRSFADSKFHTVARKDVKEVNIDTLSKPEYSLRKGCE 248

  Fly   251 AALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSS----------------DDEPH-EEKD 298
            ||..||.:..:|..|..| |..:...||.||.:.|.|..                ||||. ||:|
Zfish   249 AAKLFLQNRQIPDRWKVD-LSEILESSSSDEDDEDEDGEGKEGEEEEKEPEPEEPDDEPDPEERD 312

  Fly   299 RFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCT 363
            .|:.||||:|:|||||:||.|.:..:|::|::|||.|...||.:.:.|.:.||.|.|.||.....
Zfish   313 HFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVHIHGGCDNIESGSIWKQIYMDLGIPVLN 377

  Fly   364 VSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETIS 428
            .:....||.||:|:|..:.::.|...........|                .|:|.         
Zfish   378 SAASYNVKTAYRKYLYGFEEYCRSAQIQFRTVHHN----------------EPRPD--------- 417

  Fly   429 KLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSE--SSVVVEPPKKQRKG 491
              .||...::                           :|..:||.|..|  ..|..||...:.|.
Zfish   418 --VQPEVQSI---------------------------KSVTKESENNDEMMQQVTAEPGTSEDKP 453

  Fly   492 SAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGS 556
            :|.:.:                                         |.|.|........:..|.
Zfish   454 AADADE-----------------------------------------SDAESEKGRKDVCSPRGR 477

  Fly   557 ATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDAS 621
            ....||.:..:.|   ||.:.|        .:...:||...|.|.        ||.|..:.:...
Zfish   478 RRCLTTPVKVEME---PLKQEK--------IKEEKKKEDTQSVGE--------NSGEEPKEKSDG 523

  Fly   622 PSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKID 686
            .......|.....|...:......|..|:.....:.|:|:::|.::::....:|.:.:...|: :
Zfish   524 EIPGKRRSRRHEESDKDSEEDDDDNDDEEQDDDDEDDEEEEEDDDDEEEDYFERSRLRERDER-E 587

  Fly   687 TGDFVVG--------IGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYD 743
            .||   |        .|.|::|.|.:.|:.    ..|||.:.......|..:|||||.|||.|||
Zfish   588 EGD---GCEDSEHSLAGTKVRVKYGKGKTQ----KIYEANIKNTETDDGEVLYLVHYYGWNVRYD 645

  Fly   744 EWVPRERIAENLTKG---SKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQ------ 799
            |||..:||...:.||   .|||.:..:........              ......::|:      
Zfish   646 EWVKADRIIWPVDKGGTKKKQKKKVKNKEDEEKEK--------------EEDKTKVVVRRGRPPL 696

  Fly   800 GSQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGG---AK 861
            .|.|||.|.|.|..:|.|    ||.||    .|:.:.:|.....||..     :|..|.|   :.
Zfish   697 KSTPPGTSRKTPSSEGRS----SSKNS----RPTDASALPNGDGTPRR-----RTRRTSGMYDSD 748

  Fly   862 RG---RGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVSDASM 923
            ||   .|.|........:|......:.||..|..::.:....:.:..|...|..|.|...|    
Zfish   749 RGSNDSGNSSDDSEGEKSPEKKQEWTERTDPPPIAKQEAADDLPEESTTQEPAQTEPELPS---- 809

  Fly   924 ASESDSDSDEPVRRPKRQSAKDKPQAGKAQPP------------GKGRLASSASSTAPAAHPSDD 976
                     .|...|....::.||:...:.||            .|.||....|.| |...|:..
Zfish   810 ---------SPQEMPNFNESESKPEEDSSMPPTESDVGSPKMTAKKPRLKEPGSET-PTQTPAAA 864

  Fly   977 SEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGRDYDLSEIRSELKGFQP 1041
            :...|.||..:..|.....|:...:|.:...:          .....|.|.|     |..:...|
Zfish   865 NHHAETEEPSTPPRPVKKSQETPHSSPVERIK----------LVETAGSDTD-----SATEDIDP 914

  Fly  1042 KLLTNAASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTELSSETESYADEDSQSSDYRK 1106
            ...|:||   :||...::.|..:..| |.|:|||..|..|:|..|...|:|.           |.
Zfish   915 PERTSAA---KRKINEQRTPEKKIRL-DRKEEPKTPSPVKTSPLEKKPESEK-----------RT 964

  Fly  1107 QLKGSGAGKKEPT-ASPSK---LHHE-PVTKRELAVK--------EEPLKI-------------- 1144
            ::.........|| :||||   :..| |...||:.:|        |:|..:              
Zfish   965 EIVQKPEEPPNPTLSSPSKEVEIKSEMPSLTREVHLKLEAPCPDLEDPTTVANEEMMPQIGPEAL 1029

  Fly  1145 ----------EPKTEP--------KEEETKSKPFLSGADIKPTALIAPARFGNTSAA----QAAS 1187
                      |.|.:|        |||:...:|..|...:.....:.|.|..:.|:|    ::.|
Zfish  1030 VCHEVDLDDPEEKDKPSSEELPIMKEEKVLPQPLESPDHLHVLPAVGPPRLFSPSSAPSPDESHS 1094

  Fly  1188 SSGSSSTTAKYTSVIVEKPLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQE------ 1246
            :...|..|.:..|| .|....:|..:|.             .|..|..::::||.:.|:      
Zfish  1095 TKSESDATIEVDSV-AESQEGLGENEST-------------HSFDASASSSNSSISLQDRDGKDR 1145

  Fly  1247 -SKKFAEPVASLKVEMPAACSPSSSSSS-------SSSFCST---GSAVSSSSATRSLPDMSKLE 1300
             .|:..:            |:..|||..       ||..|.|   |:..||.|..:|:.|     
Zfish  1146 GQKRLLD------------CTTVSSSKKQKRSQKRSSVGCKTEKNGAGHSSDSEDQSVMD----- 1193

  Fly  1301 ISSGTVPGATPGAAALQPSNVAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEFKDTEP 1365
                       |:..|.|     |..|...|..|.|.|.|..:.|    .|.:..|.::.|.:.|
Zfish  1194 -----------GSNKLTP-----VKHSILPKNQKLSRSPGLGSPS----NKYIEKDKHKEKQSVP 1238

  Fly  1366  1365
            Zfish  1239  1238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 28/94 (30%)
ARID 299..381 CDD:279697 35/82 (43%)
Tudor-knot 692..751 CDD:288553 25/67 (37%)
arid4aXP_005158686.1 TUDOR 58..113 CDD:295375 35/59 (59%)
RBB1NT 171..260 CDD:285392 28/94 (30%)
ARID 311..396 CDD:198082 36/85 (42%)
Tudor-knot 601..654 CDD:288553 25/57 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104878423
eggNOG 1 0.900 E1_KOG2744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 363 1.000 Inparanoid score I2102
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 1 1.000 T1054307
orthoMCL 1 0.900 OOG5_131238
Panther 1 1.100 LDO PTHR13964
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.