DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Msl3

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_008771391.2 Gene:Msl3 RGDID:1549763 Length:531 Species:Rattus norvegicus

Alignment Length:485 Identity:89/486 (18%)
Similarity:157/486 (32%) Gaps:127/486 (26%)


  Fly   698 LKVNYHE-------KKSPSSHGSTYEAKVIEISV-----QRGVPMYLVHYTGWN-NRYDEWVPRE 749
            :|..:|.       :..|:.....|:||:|::.:     .|.:|.||:|:.||| :.:|.|...:
  Rat     7 MKFQFHSGEKVLCFEPDPTKARVLYDAKIIDVIIGKDEKGRKIPEYLIHFNGWNSSSWDRWAAED 71

  Fly   750 RIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGKD 814
            .:..:..:..:.:.:....:.|.                         ::|:.......:.||.|
  Rat    72 HVLHDTDENRRLQRKLAKKAIAR-------------------------LRGTGKKKRRCRLPGVD 111

  Fly   815 GCSKMSP------SSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAKRG---RGRSDSM 870
            ...|..|      :..||.........|...|...........|||.   |.|:.   |.|.| |
  Rat   112 SVLKSVPVKEKTKNDENSISSTCHESCGEKNGGIKEHRQRRIKVKTK---GKKKVLSLRSRKD-M 172

  Fly   871 PPRSTTPSSVVAHSGRTKSPAASQPQLQQ-----QMKKRPTRVVPGTTTPRRVSDASMASESDSD 930
            ..|:.|          .:.|...:.||:.     ..:||..: :|..|....:.::.:...:.:.
  Rat   173 DERTIT----------IEIPEVLKKQLEDDCYYINRRKRLVK-LPCQTNIITILESYVKHFAINA 226

  Fly   931 SDEPVRRPKRQSAKDKPQAGKAQPPGKGR----------LASSASSTAPAA--HPSDDSEEDEEE 983
            :.....||:...|...........|.:..          |..:...|.|..  :|         .
  Rat   227 AFSANERPRHHHAMMHAHMNVHYVPAEKNVDLCKEMVDGLRITFDYTLPLVLLYP---------Y 282

  Fly   984 EEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGRDYDLSEIRSELKGFQPKLLTNAA 1048
            |:....|..|||    ....::.|....||:                  :.||....|.|..:..
  Rat   283 EQTQYKRVTSSK----FFLPIKESTTTTNRS------------------QEELSPSPPLLNPSTP 325

  Fly  1049 SNEERKDLAKKEPSDEPALQDIKK-EPKLESSAKSSSTELSSETESYADEDSQSSDYRKQLKGSG 1112
            .:.|     .:.|:.|||....:| ||:...|.: .||..|:..:..::..|.....|:|...| 
  Rat   326 QSTE-----SQPPTGEPATPKRRKAEPEALQSLR-RSTRHSTNCDRLSESSSSPQPKRRQQDTS- 383

  Fly  1113 AGKKEPTASPSKLHHEPVTKRELAVKEEPL 1142
                  |:.|....|   .::.|:|.|.|:
  Rat   384 ------TSMPKLFLH---LEKTLSVTETPV 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 17/66 (26%)
Msl3XP_008771391.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.