DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid5a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_006244868.1 Gene:Arid5a RGDID:1311041 Length:590 Species:Rattus norvegicus

Alignment Length:404 Identity:84/405 (21%)
Similarity:134/405 (33%) Gaps:124/405 (31%)


  Fly   280 DEGEI----------DSDSSDDEP------------HEEKDRFVAQLYKYMDDRGTPLNKVPSIL 322
            :||::          |..|....|            .||:..|:..|||:|.:|.||:.:||.:.
  Rat    14 EEGDLQEPPVSPKPQDEQSKSQSPIQLEDSPKAGGEQEEEQAFLVSLYKFMKERHTPIERVPHLG 78

  Fly   323 SRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRK 387
            .:.::|:::::||:|.|.|..||.:..||.:...||.:|.:.|.....::.|::.:.||      
  Rat    79 FKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGGSPGSTSAATCTRRHYERLVLPY------ 137

  Fly   388 LGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVA 452
                                ||.......||:...|.....|:|:                 .:.
  Rat   138 --------------------VRHLKGEDDKPLPPTKPRKQYKMAK-----------------ELR 165

  Fly   453 ASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQA 517
            ........:..|..|...::..|:.     |..|....|.....:||..:...|:.         
  Rat   166 GDDGATEKLKKAKDSEERQADQTTS-----EKTKSDAPGQTQLPRQGSSRDSTEQL--------- 216

  Fly   518 TSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIATTAMNKDAESDLPLAKIK-AAA 581
               |.|:||    |...:...|...:....|:|....|:..|.:           ||||.| .|.
  Rat   217 ---GPVSGS----SPPFLGANSCPEAYKRLLASFYCKGAHGIMS-----------PLAKKKLLAQ 263

  Fly   582 VAAAST--------RHSMEKETNISSGSSASASSKANSAEMQRSRDASPSVAAPP----SAGAST 634
            |:.|..        ||...........||.:....|.::|.|         ..||    :.|.||
  Rat   264 VSKAEALQCQEEGCRHGARSPNKDLQESSQNPRGLAENSEHQ---------LTPPEGLRAPGGST 319

  Fly   635 S-----GAAATAQT 643
            .     |...||.|
  Rat   320 GVEAQVGPCPTAPT 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 26/82 (32%)
Tudor-knot 692..751 CDD:288553
Arid5aXP_006244868.1 BRIGHT 51..143 CDD:128777 31/118 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104870481
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.