DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid3a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001101536.2 Gene:Arid3a RGDID:1305299 Length:594 Species:Rattus norvegicus

Alignment Length:643 Identity:139/644 (22%)
Similarity:234/644 (36%) Gaps:151/644 (23%)


  Fly    59 PTG-QLRVGAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRH----- 117
            |.| |.|.....|.|.|:...:....:..               :..:|..|..|   ||     
  Rat    34 PAGVQARTTMTDEDREPENARMHRTQMAA---------------LAAMRAAAAGL---RHPSSPG 80

  Fly   118 -FNESETLDQLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDD-----DESDAKEVVNEKEENIG 176
             ..:.:|.....|:.|...|:...|.......|||.:..|:||     :|.:.:|:..|:||...
  Rat    81 GSEDEDTAQGGTLSSPALHGSGQEGPGHTEGDGHLMDMGSDDDTKPKWEEQELEELGEEEEEEDE 145

  Fly   177 KVVCVETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVA 241
            .    :.|.:::|:|                     :|.|      |...:.....|..|||:..
  Rat   146 D----DFEEEEEDEE---------------------EEGL------GLPESASLGSAGLFTRKAP 179

  Fly   242 SKQDV-----PAVQAALEFLDSSVLPAHWDRDSLFGLTNISSD----DEG------------EID 285
            ..|..     |.:.:..|.|...  |||        .::::|.    |.|            |:|
  Rat   180 PTQTFRGDGGPRMLSGPERLGPG--PAH--------PSHVASQMPPPDHGDWTFEEQFKQLYELD 234

  Fly   286 SDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQW 350
            :|       .::..|:..|:.:|..||||:|::|.:..:.:||:.|:..|.::||...|.::..|
  Rat   235 AD-------PKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLW 292

  Fly   351 KLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGC-SMLMTSRNSNRSKGR--------- 405
            :.|...|.......|....::..|.|:|.||....|.|.. :.|..:.:|||.:||         
  Rat   293 REITKGLNLPTSITSAAFTLRTQYMKYLYPYECERRGLSSPNELQAAIDSNRREGRRQSFGGSLF 357

  Fly   406 --SLVRANS-VASPK------------------PMETMKTETIS--KLAQPNQTNVVASTSSSAA 447
              |...|:| ::|||                  |...:|.|..|  .:..|.:..|..:.....|
  Rat   358 AYSPSGAHSMLSSPKLPVTSLGLAASTNGSSITPTPKIKKEEDSAIPITVPGRLPVSLAGHPVVA 422

  Fly   448 AASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKS 512
            |.:.|..:..|:|...|..:|.|:.....||:   |||:| :....|..||..::..|::.....
  Rat   423 AQAAAVQAAAAQAAVAAQAAALEQLREKLEST---EPPEK-KMALVADEQQRLMQRAVQQSFLAM 483

  Fly   513 TAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIATTAMNKDAESDLPLAKI 577
            ||....:....:.:..|....|:..|||..|.:.::|...:|   .:.|..:........|....
  Rat   484 TAQLPMNIRINSQASESRQDPAVNLTSANGSNSISMSVEMNG---IVYTGVLFAQPPPPTPPPAS 545

  Fly   578 KAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDASPSVAAPPSAGASTS 635
            ....|::..|.::|...|..|  .||.:|.:...|          .|:||..:..|.:
  Rat   546 SKGGVSSIGTNNTMGNRTGAS--GSAGSSGQVGLA----------GVSAPTMSSTSNN 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 16/96 (17%)
ARID 299..381 CDD:279697 24/82 (29%)
Tudor-knot 692..751 CDD:288553
Arid3aNP_001101536.2 BRIGHT 237..329 CDD:128777 26/92 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.