DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid4a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001101499.1 Gene:Arid4a RGDID:1307442 Length:959 Species:Rattus norvegicus

Alignment Length:1126 Identity:222/1127 (20%)
Similarity:356/1127 (32%) Gaps:388/1127 (34%)


  Fly   273 LTNISSDDEGEIDSDSSDDEPH-----------------EEKDRFVAQLYKYMDDRGTPLNKVPS 320
            |.:.||||| |..::..::|..                 ||:|.|:.||||:|:||.|  ||.  
  Rat     7 LESSSSDDE-ECPAEEHEEEKEKEAKKEEEELPEEELDPEERDNFLQQLYKFMEDRVT--NKT-- 66

  Fly   321 ILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFH 385
                     .:|          ::.|...||.|.|.||......:....||.||:|:|..:.::.
  Rat    67 ---------LIF----------QIDSGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFEEYC 112

  Fly   386 RKLGCSMLMTSRNSNRSK------GRSLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSS 444
            |...........:..:.|      ..|:..|..||...|:..:|:|                   
  Rat   113 RSANIQFRTIHHHEPKVKEEKKDFEESMDEALKVAQEMPLMDVKSE------------------- 158

  Fly   445 SAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLV--EK 507
                        |...:.:.|:|..|::        .::.|:.:||   ...:...:|..:  ||
  Rat   159 ------------PEENIDSNSESDREDT--------ELKSPRGRRK---IVREANCIKKELEEEK 200

  Fly   508 YEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIATTAMNKDA-ESD 571
            .|:|                                              .|.....|||| :.|
  Rat   201 IEDK----------------------------------------------LIGDDIDNKDADDDD 219

  Fly   572 LPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDASPSVAAPPSAGASTSG 636
            ..:|:               :|||.:..|...:...|                            
  Rat   220 YDIAE---------------KKETELLLGRKTTPKHK---------------------------- 241

  Fly   637 AAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVN 701
                     .||.|.|...:.|.|::::|.:::..:..|...:...::.||...:.  |.|:||.
  Rat   242 ---------EKKIKQQEDSERDSEEEEEKSQEREETESRCDSEGEDDEDDTEPCLT--GTKVKVK 295

  Fly   702 YHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTI 766
            |...|:.    ..|||.:....:..|..:|||||.|||.||||||..:||...|.||..:|.:..
  Rat   296 YGRGKTQ----KIYEASIKSTEMDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGGPKKKQKK 356

  Fly   767 STSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGKDGCSKMSPSSGNSTGPGA 831
            ...:...                                 |:|...:|       .....:..|.
  Rat   357 KVKNKED---------------------------------SEKDEKRD-------EERQKSKRGR 381

  Fly   832 PSLSGSLGGASSTPSLLSTVVKTPPTGGAKRGRG-RSDSMPPRSTTPSSVVAHSGRTKSPAASQ- 894
            |.|..:.  :|:.|..||....:....|.:...| .:.||...::..|...|.....||..:.: 
  Rat   382 PPLKSTF--SSNMPYSLSKTSNSEGKSGTRSAHGIVTGSMALSNSCSSDSEAEDQLEKSSVSEEL 444

  Fly   895 -PQLQQQMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKR---QSAKDKPQAGKAQPP 955
             |.::::::|           ...|.|..:|.|:          ||.   .:..|:.||..::| 
  Rat   445 SPDIKEELEK-----------SENVHDDKLAEEN----------PKTVHISNENDRTQAQPSEP- 487

  Fly   956 GKGRLASSASSTAPAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAA 1020
                |...|..:....|...|..|..||          .|:|.:::...:|.|   |:.......
  Rat   488 ----LTVEAGDSDQIVHIFGDKVEQAEE----------LKKQVEKSPKAKGRR---NKTKDLSLE 535

  Fly  1021 SAKGRDYDLSEIRSELKG------FQPKLLTNAASNEERKDLAKKEPSDEPAL---QDIKKEPKL 1076
            ..|...:...|..||.:|      |......|.:|.|:..|..:||...:..:   ...:|:.:|
  Rat   536 LIKISPFSQEEAGSEARGDTHSLEFSSLECKNFSSTEDDVDQYEKEKKLKRKILGQHSPEKKLRL 600

  Fly  1077 ESSAKSSSTELSSE--TESYADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKE 1139
            |:..: .:|.||.|  .:|...|..:.....::.:..|.|.....|.|.:...||...:..:..|
  Rat   601 ENGVE-MTTGLSQERSDDSAVAEGVKGVHVEQRFEAEGEGMPSLIAEPDQGIQEPTGVKPDSPAE 664

  Fly  1140 EPLKIEPKTEPKEEE----------------------TKSKPFLSGADIK----------PTALI 1172
            ||    ..|..||||                      .|.||.:....|:          |.|| 
  Rat   665 EP----AHTPLKEEEDVMPLIGPETLVCHEVDLDDLDEKEKPSIEDVVIEGSESNSLGSVPPAL- 724

  Fly  1173 APARFGNTSAAQAASSSGSSSTTAKYTSVIV-----------------------EKPLTIG---- 1210
            .|....|.|.|...:.|...|.:.|..|.|.                       |..:|.|    
  Rat   725 PPVAQQNFSVASPLTLSQDESRSIKSESDITIEVDSIAEESQEGLCERESANGFEASVTSGACGM 789

  Fly  1211 ----------GKK-----------SVEQHVPKK-AELLKKQSGGAGGTAASSSAASQESKKFAEP 1253
                      |:|           ..::..||: :...|.:..|||.::.|....:.:|.....|
  Rat   790 IVHERESREKGQKRPSDANSGLMAKKQKRTPKRTSAAAKSEKNGAGQSSDSEDLPAMDSSSNCTP 854

  Fly  1254 VASLKV-------EMPAACSP 1267
            |..|.:       ..||..||
  Rat   855 VKRLSLPKPQKLPRSPARISP 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 25/82 (30%)
Tudor-knot 692..751 CDD:288553 25/59 (42%)
Arid4aNP_001101499.1 ARID 47..113 CDD:295405 26/89 (29%)
Tudor-knot 288..342 CDD:288553 26/60 (43%)
Ehrlichia_rpt 437..>850 CDD:118064 90/458 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104880373
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4321
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13964
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.