DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htk and Msl3l2

DIOPT Version :9

Sequence 1:NP_573330.3 Gene:htk / 32877 FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001014054.1 Gene:Msl3l2 / 309790 RGDID:1308699 Length:371 Species:Rattus norvegicus


Alignment Length:279 Identity:60/279 - (21%)
Similarity:98/279 - (35%) Gaps:69/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   858 GGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQ---PQLQQQ----------MKKRPTRVV 909
            ||:.||.|     .|:......|.||:.|.....|.:   |::.||          .::|..|:.
  Rat    18 GGSDRGDG-----DPKPKGKKEVEAHTRREADERAVRIPIPEVLQQRLADDCYYINRRRRLVRLP 77

  Fly   910 PGTTT-------PRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQAGKAQPPGKG-RLASSASS 966
            ..|..       .|..|.:::||..        |||:.|.|..:...|..:....| |:....:.
  Rat    78 CQTNVGAILECYVRHFSASALASGD--------RRPQPQRAAPERSVGLCREMADGLRITFDHAL 134

  Fly   967 TAPAAHPSDDSEED----------EEEEEPSAARA------ASSKQQQQQASSLRGSRAGGNRAM 1015
            .....:|.:.::.:          .||....|.|:      ..|..|..::.::.|..|...|.:
  Rat   135 PLVLLYPQEQAQYEMVTSSTFFFPTEERASDAGRSQEAPWPGPSPPQPSESQAMAGPTAPKRRRV 199

  Fly  1016 SSGAASAKGRD-------YDLSEIRS--ELKGFQPKLLTNAASNEERKDLAKKEPSDEPALQDIK 1071
            .:.||.|..|.       :..:|.|:  :.|...|||..:          .:|.|....||..|.
  Rat   200 ETDAARAPRRSTRHSTHCHWQAEDRASPQAKRSVPKLFPH----------LQKTPVHSTALSPIA 254

  Fly  1072 KEPKLESSAKSSSTELSSE 1090
            ..|..|.||..:..|.::|
  Rat   255 LTPGKEGSAMFAGFEGTTE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553
Msl3l2NP_001014054.1 MRG 33..356 CDD:399022 54/259 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.