DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Usf3

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_001067438.2 Gene:Usf3 RGDID:1560175 Length:2222 Species:Rattus norvegicus

Alignment Length:1748 Identity:362/1749 (21%)
Similarity:610/1749 (35%) Gaps:413/1749 (24%)


  Fly   889 SPAASQPQ---LQQQMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQAG 950
            |||..|.:   |.|..|.        .|..:|.:|..:.:...|:..|.:::.::|..:.:.:.|
  Rat    48 SPALKQSKNMILDQAFKY--------ITELKRQNDELLLNGGSSEQAEEIKKLRKQLEEIQKENG 104

  Fly   951 ------KAQP---------PGKGRLASSASSTAPAAHPSDDSEED----EEEEEPSAARAASSKQ 996
                  ||..         ..||.|.:|..|   ...|||..:::    ....:|......::.|
  Rat   105 RYIELLKANDICLYDDPTIHWKGNLKTSKVS---VVIPSDQVQKNIIVYSNGSQPGGNSQGTAVQ 166

  Fly   997 ----------QQQQAS--------------SLRGSRAGGNRAMSSGAASAKGRDYDLSEIRSELK 1037
                      |:|.|:              |:.|.....|:.......||...:..:        
  Rat   167 GITFNVGHGLQKQTANVVPVQRTCKLVTPVSISGIYPSENKPWHQTTVSALAANQSV-------- 223

  Fly  1038 GFQPKLLTNAASNEERKDLAKKEPSDEPAL---------QDIKKEPKLESSAKSSSTELSSETES 1093
               |..|..|.|.:...:|:..| |...||         ..:..:|....|..:...:.::...|
  Rat   224 ---PLCLPTAISAQNILELSTSE-SQSSALGATGGSVVTTSVGPDPHQHRSLNTCLNDQNASENS 284

  Fly  1094 YADEDSQSSDYRKQLKG-SGAGKKEPTASPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETKS 1157
            ...|..:||  :|.:.. ||.......|:|. :|||  ||..||.:.                  
  Rat   285 NVQESPKSS--KKTVSSVSGTSSSNSAAAPG-VHHE--TKSSLATQG------------------ 326

  Fly  1158 KPFLSGADIKPT--ALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVEQHVP 1220
                |.||.:.|  ::..|.      ::|...|:||||            |:::  .|:|:    
  Rat   327 ----SSADSQNTLVSITTPV------SSQPPRSTGSSS------------PVSV--SKTVD---- 363

  Fly  1221 KKAELLKKQSGGAGGTAASSSAASQESKKFAEPVASLKVE-----MPAACSPSSSSSSSSSFCST 1280
                        ...|||:...|.....|.|.||:||...     ...:||..|||.|:|...:.
  Rat   364 ------------PTNTAAAVVPAHTAVSKSALPVSSLSATPLEGGWTLSCSLPSSSVSASELKNI 416

  Fly  1281 GSAVSSSSATRSLPDMSKLEISSGTV-PGATPGAAALQPSNVAQVSSSGAAKESKYSSSGGAAAG 1344
            .|....|||..:....:.|.::..|: |.:.|.::|..|: :.:..:|......|:.::|.....
  Rat   417 NSLTRISSAGNTQTTWTTLHLAGNTIQPLSQPPSSASTPA-LNECGTSPTPSNHKHMATGITFNN 480

  Fly  1345 S-------------------GISMRKLLSSDVYEFKDTEPFEFEKRISPMASVGGTV-AAAATAA 1389
            |                   .:.|:.|::..  :.|...|    |.|.|:.|....: .|....:
  Rat   481 SPPTDGQPVEQIVVTLPSCPPLPMQPLIAQP--QVKSQPP----KNILPLNSAMQVIQMAQPVGS 539

  Fly  1390 GAMAAAGAASVITTMVPTPGASGSGVAASASTSA---PVVVGSAARKQALKASAIQHILEHQSPA 1451
            |..||....:||....|:.....:.:.|..|..|   .:|:..||.:..|...:..|....:.|.
  Rat   540 GVTAAPANQNVIILQPPSTTPCPAMMRAEVSNQAVGQQIVIIQAANQNPLPLLSAPHPGPVRLPV 604

  Fly  1452 AGRERGGYGGMTSSISLLTAPK---------LKKRGSPLKEAALCMEKAKTYKLDKDQVQQP-VE 1506
            .|  .....|..:|:..:.||:         :..|.|.|..:    ..|:|:.:.....||| ..
  Rat   605 NG--ASAIIGSHNSVQNVPAPQTFGGKHLVHILPRPSSLSTS----NSAQTFSVTMSNQQQPQTI 663

  Fly  1507 QKTQQLIQPTLGPVESYGAGSPEAMSNLSTPTTSSGHAQLSASSTYSQLTPHHATPFDALRKSPS 1571
            ....||.  .|.||.|....:.::...:..||||.......|.:|:..|.        :|.:|.|
  Rat   664 SLNGQLF--ALQPVMSSSGTTNQSPMQIIQPTTSEDPNTNVALNTFGALA--------SLNQSIS 718

  Fly  1572 FNLNITALNEELAQTVQETTRALTDALQPPS----TPVPPTVSASGSTPTAVTPVITAMPTAGTA 1632
            .....:.:...::|:....|.| .....|.:    |.|.||::|..|...:.|..:....:..| 
  Rat   719 QMAGQSCVQLSISQSANPQTSA-NSQTSPTNCVSLTTVAPTMTAENSATQSTTYSLATASSTNT- 781

  Fly  1633 GLSC-PSTPPTGANPVLASPKLSTPPQAINASKQPPASHIVGSPFIETRNVFE-----LSTSNEG 1691
             ::| |||        :.|.:||..|.|    |:..|::....|....|:|.:     :.:|.|.
  Rat   782 -VTCLPST--------MKSKRLSKKPSA----KKHLAANKPACPLNSVRDVGKMDGPGMDSSAEP 833

  Fly  1692 S-----------GYSS---GESKDNKFEKLENVKILLAGAVGP-FDLDAGSYEQKTSS-----IA 1736
            |           |.||   .::|........::.||.:.:|.| .|..:.|.|..:||     ..
  Rat   834 SCSDGLLNGLPVGLSSVTVSQAKSVSISASHSLDILNSESVIPESDSKSKSAEDCSSSSRESEAN 898

  Fly  1737 DKVLKAISQKKEEV----ENNKGKPPVE---PAAAAKTPGREDVVPSPTAKLDLCSSAIKLDTLK 1794
            :::..|.::.|:..    |:::|.||..   |.|.........:.||||....|.|....:.:..
  Rat   899 EQLALATAKSKDSTPILQESSQGTPPCSVALPNATKSCASANVLTPSPTESESLVSQVSGMPSTT 963

  Fly  1795 LLSEPLKIQTGPLLGELYRPGPATSSPETKSILESSLPAKNSELSETIQKL--ECAIQQRKTPV- 1856
            ..|..:.|....::.|     |.....|:...::::.|.|...|:..:..|  |..:|:...|| 
  Rat   964 STSNTVCISEVEIVAE-----PCPVQQESLDTMQAAGPLKGQGLTMLLSDLAKEKDLQRTSLPVQ 1023

  Fly  1857 --GGALSLASSTAGTPPTAHTPNSTATAGAGFSDESMDSTDSEQRLVIEDVIAEEHTTTTTTGEQ 1919
              ....|..||..|.|.....|.....    .:.:..|.......|..::||   |.:..|:.:.
  Rat  1024 MDHPDFSPESSKIGDPNVDLHPKQELL----LTSDDRDLPQPHSCLPDQEVI---HGSLLTSRQA 1081

  Fly  1920 KSPGSQQEEGQTNTATMATAV--TAETEGTSSSTPT--------------PPVPAPVKLELGAKA 1968
            .||.| ...|.:.:.::|:.:  ||..:.|||:|.|              ....|.:..|...|.
  Rat  1082 DSPMS-TSSGSSRSFSVASMLPETAREDVTSSTTNTCDSCTFAEQTDIVALAARAILDQESIEKG 1145

  Fly  1969 MPGIQA---PIPLKPAEGSSFAGKLTGVVQPPPLAKLQQQEELGQAQGQSKSISS-------FGI 2023
            ..|.||   .:..||:|.|     |.|  ..|...::.::...|||.......:|       ...
  Rat  1146 RLGTQADLKDVTPKPSETS-----LEG--DQPFKPQIHKETCTGQADPTPNEFNSQDSVEVTVDR 1203

  Fly  2024 PIVLPEIPASVVVATPALMVASAATVMRHSPGSTPNSQAPVLISPKTFLTAPKVGEVGGLLLKAY 2088
            |:..|.....:..:.|.|.|::              ||.|.| :.:..::.|.|...|.......
  Rat  1204 PLEKPSCSLGIKASNPPLQVSA--------------SQPPSL-THQNSISRPLVSCAGLSQSSDQ 1253

  Fly  2089 TGVSGAVGAAPAGSVIASAGGGGTPTV---ISNFPQQQQQASVLQASSEMPANYVLDAEMAEP-- 2148
            |.:...|     ...:||:..|..|.|   ::.:.|:|..:.         ||.:.:.::.||  
  Rat  1254 TAIPVTV-----NMTVASSAYGSQPPVPPLMTEYSQEQLNSM---------ANSIPNPQVQEPLS 1304

  Fly  2149 -------SNSSAPVVARPFVMHAVGKELFNVVAP--AASSPLIS-DPHN--ESINLLCEETIPGS 2201
                   .:|:...|....::.:..::.....||  ..|.||:| .|.|  :...::..:..|.|
  Rat  1305 KPSHESRKDSAKRTVQDDLLLSSAKRQKHCQPAPLRLESVPLMSRTPDNIPDQTQMMASQITPNS 1369

  Fly  2202 ---------PAPNYGGTDQLPTAVNSALAIVGITPLPPDTPPPVPVAAIQQQQQHQLQSGQQQQA 2257
                     ||...|.|...|...|.|..::....:..:..|.|      .:|..|.|:||..||
  Rat  1370 SNSVVPVSNPAHGDGLTRLFPAGNNFAAPVLRQADVQCNPQPSV------AEQPQQTQAGQHLQA 1428

  Fly  2258 AKTGEVNPSGPNS-------SPDSASQDESGEEAKKN--AGLEHEDSTGLGALNKRKRNRKPLPM 2313
            .:. .|.|.|.:.       ......|.::|:..:::  ..|:|.......|::.     :|..:
  Rat  1429 LQQ-HVPPQGVSHLHTNHLYLKQQQQQQQAGQLRERHHLYQLQHHVPHADNAVHS-----QPHIV 1487

  Fly  2314 SAQTAAAVAAQLQSLGKRRRQVSGMRNQKTTTTAAGSDTDDN---SDNIAPNAGQQQQQPRQ--- 2372
            ..|.......|:|   |:|..|.|....:.:.......||.:   |....|:..|.|||.:|   
  Rat  1488 HQQRTLQQEVQMQ---KKRNLVQGTPTSQLSLQPKHHGTDQSRPKSSQPHPHHQQMQQQLQQHFA 1549

  Fly  2373 ------------SARQHMMPQSNAQQQQQQQLLQQQQ----TQLPQGIQSTNSSGVRP 2414
                        |:|.|   .|:.|....|.:|.|||    .|....:.|.:.||..|
  Rat  1550 SSQPEKSCENPSSSRGH---HSHPQNHLNQDVLHQQQDVGSRQQGSAVSSDHVSGHNP 1604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553
Usf3XP_001067438.2 HLH 20..70 CDD:278439 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.