DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and RGD1564748

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_008756575.1 Gene:RGD1564748 RGDID:1564748 Length:2298 Species:Rattus norvegicus

Alignment Length:2384 Identity:480/2385 (20%)
Similarity:757/2385 (32%) Gaps:693/2385 (29%)


  Fly   106 RRTALCLKSGRHFNESETLDQLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDDDESDAKEVVNE 170
            |.|.....:|||.:||....: .|..||. .|.........:...|.:|..||......|....|
  Rat   151 RMTQKSASAGRHHSESHRSGK-TLRFPEK-SNIKENHHSSVKHSSLEKDHPEDRGRPIKKRCPTE 213

  Fly   171 KEENIGKVVCVETESKKKDKEKWFPALVVAPTAQATV---RIRVKDEYLVRSFKDG-RYYTVPKK 231
            |.::..|....|..|.....|:..|.....||.:...   |...|..|..::.... |.:.:.:.
  Rat   214 KSQSTEKGQLTERSSYAPATERGRPTKRSQPTKKGLSNENRHPAKKGYSAKTPGSAERDHQIERG 278

  Fly   232 EATE----FTREVASKQDVPAVQAALE--------FLDSSVLPAHWDRDSLFG-----LTNISSD 279
            .||:    ..::..|::..||.::.||        ..:|.|:.|  ::|.|.|     .:|.|.:
  Rat   279 GATDSGLSTEKDCPSRRRRPAKKSHLEEKVHSQKSSYESRVISA--EKDGLAGRVRRKRSNPSEE 341

  Fly   280 DEGEIDSDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRV 344
            ......|......|...|||.|    :...|:..|        ..|      .|:|:.....:|.
  Rat   342 GHSVKCSICDSSVPSAGKDRPV----RSRSDKSNP--------GED------RRSVESGISASRG 388

  Fly   345 TSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRS--- 406
            .|..:         .:|......|.:::|.|.....||      ..:....|...:|..||.   
  Rat   389 PSAGK---------DSPAGRGRPNKIRRAEKGHSMEYG------SSAPRGPSAGKDRPGGRGHPN 438

  Fly   407 ---------LVRANSVASPKPMETMKTETI-------SKLAQ----------------------- 432
                     .|.:::.||..|..|.|...:       :.||:                       
  Rat   439 KSGPTEESRSVESDTCASKGPSTTGKERPVRRCRLNKNSLAERLCSIQCGICTPRGPSAGKHCSE 503

  Fly   433 ----PNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSA 493
                ||: .|.|....|  ..:::||..|:......::|.:.:||.|.|...|        :||.
  Rat   504 RRGRPNK-RVPAEEDRS--LKNISASRRPSGGKDRPARSRSNKSGPTKEGWSV--------EGSR 557

  Fly   494 ASS---QQGK---------VKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTAT 546
            ::|   .:||         .||..||........::||.|..||...||..:   :::.:..|..
  Rat   558 STSGRPSEGKDRSGGRGRPNKSGPEKEGPSVNDSRSTSRGPSAGKDRSARRS---SSNKSGPTEE 619

  Fly   547 NLS---------SATSGGSATIATTAMNKDAESDLPLAKIKA--AAVAAASTR--HSME----KE 594
            :||         ..::|.........:||::.:: ....||.  .|:...|||  ||.|    ||
  Rat   620 SLSDERDICESRGPSTGKERPARKCRLNKNSLAE-QWCSIKCGICALKQFSTRKDHSRERGRSKE 683

  Fly   595 TNISSGS-------------------------------------------------------SAS 604
            :.:..||                                                       :.|
  Rat   684 SGVEVGSHLVKSGVSTPRGPSAGKDLPAGRGRPNKSSPAEEGCSVKSSISASRRPSVGRDRPARS 748

  Fly   605 ASSKANSAEMQRSRDASPSVAAPPSAGASTSGAAATAQTASNKKE----KHQRSKQADKEKDKDK 665
            .|:|:.|||...|..........||||....|........|.|||    |..||........||:
  Rat   749 CSNKSGSAEESCSVKCGICTPKVPSAGKDRPGGRGCPNKNSPKKEDPSVKGGRSTSRGPSAGKDR 813

  Fly   666 EEKQASSGKR--KKEKISVEKIDTGDFVVGIG-----DKLKVNYHEKKSPSSHGSTYEAKVIE-- 721
            ...:..:.|.  .:|..|||    |......|     |:.....|..||    |...|::.:|  
  Rat   814 SGGRGHTNKSGPAEESRSVE----GSRSTSRGPSAGKDRSGRRRHTNKS----GPAEESRSVEGI 870

  Fly   722 ISVQRGVPMYLVHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGG 786
            .|..||.       :...:|     |..|...|.:...|:......:.|.:.|...|....||.|
  Rat   871 RSTSRGP-------SAGKDR-----PGRRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRSGGRG 923

  Fly   787 --GGGGGGGGSLLVQGSQP----PGVSDKQPGKDGC-SKMSP-------------SSGNSTGPGA 831
              ...|....|..|:||:.    |.....:||:.|. :|.||             |.|.|||...
  Rat   924 HTNKSGSAEESHSVEGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSTGKDR 988

  Fly   832 PSLSG------------SLGGASSTPSLLSTVVKTPPTGGAKR--GRGRSDSMPPRSTTPSSVVA 882
            |...|            |:.|:.||        ...|:.|..|  |||..:...|:...| ||..
  Rat   989 PGRRGYPNKNSPKKEGPSVKGSRST--------SRGPSAGKDRPGGRGYPNKSSPKKEGP-SVKG 1044

  Fly   883 HSGRTKSPAASQPQLQQQMKKRP-TRVVPGTTTPRRVSDASMASESDS-----DSDEPVRR---- 937
            ....::.|:|.        |.|| .|..|..::|::...:...|.|.|     ..|.|.||    
  Rat  1045 SRSTSRGPSAG--------KDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYPN 1101

  Fly   938 ---PKRQSAKDK--------PQAGKAQPPGKGRLASSASSTAPAAHPSDDSEEDEEEEE----PS 987
               ||::....|        ..|||.:|.|:||  |:.||      |:::|...|....    ||
  Rat  1102 KNIPKKEGPSVKCSRNTSRGSSAGKDRPGGRGR--SNKSS------PTEESRSVEGSRSTSRGPS 1158

  Fly   988 AARAASSKQQQQQASSLR--GSRAGGNRAMSSGAASAK---GRDYDLSEIRSELKGFQPK----L 1043
            |.:....::.....||.:  ||...|:|:.|.|.::.|   ||       ||......||    .
  Rat  1159 AGKDRPGRRGYPNKSSPKKEGSSVKGSRSTSRGPSAGKDRPGR-------RSYPNKSSPKKEGPS 1216

  Fly  1044 LTNAASNEERKDLAKKEPSDEPALQDI---KKEPKLESSAKSS---------------STELSSE 1090
            :..:.|........|..|.....|.:.   ||.|.::.|..:|               |.:.|..
  Rat  1217 VKGSRSTSRGPSAGKDRPGGRSHLNECGPEKKCPSVKDSRSTSRGPSAGKDRPGRRGRSNKSSPT 1281

  Fly  1091 TESYADEDSQSSDYRKQLKGSGAGKKEP-------TASPSKLHHEPVTKRELAVKEEPLKIEPKT 1148
            .||.:.|.|:|:.     :|..|||..|       .:||.|  ..|..|...:....|...:...
  Rat  1282 EESRSVEGSRSTS-----RGPSAGKDRPGRRGYPNKSSPKK--EGPSVKGSRSTSRGPSAGKDHP 1339

  Fly  1149 EPKEEETKSKPFLSGADIK--------PTA-LIAPARFG---NTSAAQAASSSGSSSTTAKYTSV 1201
            ..:....||.|...|..:|        |:| ...|.|.|   .:|..:...|...|.:|::..|.
  Rat  1340 GRRSYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSA 1404

  Fly  1202 IVEKPLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQESKKFAEPVASLKVEMPAA-- 1264
            ..::|    |::.    .|.|.  :.|:.|.:...:.|:|..|...|           :.|..  
  Rat  1405 GKDRP----GRRG----YPNKN--ISKKEGPSVKCSRSTSRGSSAGK-----------DRPGGRG 1448

  Fly  1265 ----CSPSSSSSSSSSFCST--GSAVSSS-SATRSLPDMS-------KLEISSGTVPGATPGAAA 1315
                .||:..|.|.....||  |.:|... ...|..|:.:       .::.|..|..|::.|.. 
  Rat  1449 RSNKSSPTEESRSVEGIRSTSRGPSVGKDRPGRRGYPNKNIPKKEGPSVKCSRSTSRGSSAGKD- 1512

  Fly  1316 LQPSNVAQVSSSGAAKESK-----YSSSGGAAAGSGISMRKLLSSDVYEFKDTEPFEFEKRISPM 1375
             :|....:.|.|...:||:     .|:|.|.:.|...|.::...|.....::...|:..:..|..
  Rat  1513 -RPGGRGRSSKSSPTEESRSVEGIRSTSRGPSVGKDHSGKRGHPSKRGPEEEGPSFKGSRSTSRR 1576

  Fly  1376 ASVG-------------GTVAAAATAAGAMAAAGAASVITTMVPTPGASGSGVAASASTSAPVVV 1427
            .|||             |......:..|.::.:..:||        |...||.....:...|...
  Rat  1577 PSVGKDRSGGRGHSNKSGPEKGDPSVKGRLSISRGSSV--------GKDHSGGRGHPNERGPEKE 1633

  Fly  1428 GSAARKQALKASAIQHILEHQSPAAGRER-GGYGGMTSSISLLTAPKLKKRGSPLKEAALCME-- 1489
            |.:|:.....:         :.|:.|::| ||.|....|......|.:|...|..:.:::..:  
  Rat  1634 GPSAKGSRSTS---------RGPSVGKDRSGGRGHSNKSGPEKEGPSVKGSRSTSRGSSVGKDRR 1689

  Fly  1490 --KAKTYKLDKDQVQQPVEQKTQQLIQPTLGPVESYGAGSPEAMSNLSTPTTSSGHAQLSASSTY 1552
              :..:.|...::....|:........|:||.....|.|.|    |.|.|.......:.|..:: 
  Rat  1690 GGRGHSNKSGPEREDPSVKGSHNTSRGPSLGKDRPGGRGHP----NKSGPAEKIRSVESSTCAS- 1749

  Fly  1553 SQLTPHHATPFDALRKSPSFNLNITALNEELAQTVQETTRALTDALQPPSTPVPPTVSASGSTPT 1617
                           |.||      |.||..|:.......:|.:..                   
  Rat  1750 ---------------KEPS------AGNERPARRYHSNKSSLAEGC------------------- 1774

  Fly  1618 AVTPVITAMPTAGTAGLSCPSTPPTG--------ANPVLASPKLSTPPQAINASKQPPASHIVGS 1674
                      .:..:|:..|..|..|        .|...::.|..:...:.|.|:.|.|..    
  Rat  1775 ----------CSIKSGICVPRGPSAGNDHCGRGRPNKSGSAKKSHSVEHSSNISRGPSAGK---- 1825

  Fly  1675 PFIETRNVFELSTSNEGSGYSSGESKDNKF-------EKLENVKILLAGAVGPFDLDAGSYEQKT 1732
                     :.|||.      ||.||.|:.       ||....|      .||.........::.
  Rat  1826 ---------DRSTSR------SGPSKKNQLAQEGPSKEKESYAK------RGPSKRKEHHAGRRP 1869

  Fly  1733 SSIADKVLKAISQKKEEVEN-NKGKPPVEPAAAAKTPGREDVVPSPTAKLDLCSSAIKLDTLKLL 1796
            :|         ||.:||..: .:||....|:|....|..:...|..                   
  Rat  1870 NS---------SQHEEEFRSFGRGKSKRGPSAGKDHPTGKGQPPKK------------------- 1906

  Fly  1797 SEPLKIQTGPLLGELYRPGPATSSPETKSILESSLPAKNSELSETIQKLECAIQQRKTPVG---- 1857
            |.|.|..:....|.....|.:|.....   .:...|.|.|...|....:|...::||...|    
  Rat  1907 SRPEKDSSSAERGNHAERGQSTGKDHP---TDRGQPRKKSHPEEVGHSVEKGNEERKPSAGKDPH 1968

  Fly  1858 ---GALS---------LASSTAGTPPTAHTPNSTATAGAGFSDESMDSTD--------------- 1895
               |..|         |::|....||..|.|..........|.|.:.|.:               
  Rat  1969 TKRGRPSKKSHPAERHLSASMKYCPPKKHRPAENVCVKRVRSPERVHSMERGHIAKRSCLAERQL 2033

  Fly  1896 -------SEQRLVIEDVIAEEHTTTTTTGE-------------------QKSPGSQQEEGQTNT- 1933
                   :|:...:|..::||.....|..:                   :.|.||.....:.|. 
  Rat  2034 SAEEGSMAEEGCSVETDLSEERAEEGTVVDNMCSVENGHPSMEKVFLEVKPSSGSMSRVTEPNNL 2098

  Fly  1934 -ATMATAVTAETEGTSSSTPTPPVPAPVKLELGAKAMPGIQAPIPLK------------------ 1979
             :|....:.::|... :..|...:|..||:::|.:    ::.|..||                  
  Rat  2099 QSTPEKRIDSDTNQV-AQVPHCNLPVTVKIKMGVE----LRVPDELKSRLVEDWDLINKQKQLFQ 2158

  Fly  1980 -PAEGS--SFAGKLTGVVQPPPLAKLQQ----------QEELGQAQGQSKSISSFGIP------I 2025
             |||.:  :...:....|:...||..::          :|...:..| ::.:..|..|      :
  Rat  2159 LPAEKNVDTILAEYVTFVKSQGLADNREYSVDEVVAGIREYFNRMLG-TQLLCQFEKPQYAEIHL 2222

  Fly  2026 VLPEIPASVVVATPAL--MVASAATVMRHSPGSTPNSQAPVLIS 2067
            ..|:||.|.|...|.|  :.....|.:.:||   .|.|:.:|:|
  Rat  2223 AYPDIPMSQVYGAPHLLRLFVKIGTALANSP---LNRQSLLLVS 2263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 21/107 (20%)
ARID 299..381 CDD:279697 13/82 (16%)
Tudor-knot 692..751 CDD:288553 14/66 (21%)
RGD1564748XP_008756575.1 MRG 2124..2281 CDD:283390 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.