DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and sol1

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_595529.1 Gene:sol1 PomBaseID:SPBC30B4.04c Length:865 Species:Schizosaccharomyces pombe

Alignment Length:210 Identity:53/211 (25%)
Similarity:91/211 (43%) Gaps:29/211 (14%)


  Fly   298 DRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGF-TP 361
            |:|:..|..:|:.||||:...|.|.:..::|..|:..|.:.||..:|::.|.|..|:..||| :|
pombe   192 DKFMVSLISFMEKRGTPIKSYPQINNTPINLMMLYALVMRAGGSRQVSAHNFWPKISASLGFPSP 256

  Fly   362 CTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASP-----KPMET 421
            ..:|   |:.|.|..:|.||.:      ..:....:..:..:.::...||..:.|     ||::|
pombe   257 DAIS---LLIQYYNSYLLPYEE------AWLAAQQQQKSLQQAKANHSANVQSRPKNYPQKPVQT 312

  Fly   422 ----------MKTETISKLAQP----NQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEES 472
                      |.....||...|    |:.:..|.|:.|:...:....|.|.|......|:::..:
pombe   313 TPEAVHANGSMHGSLHSKSPSPAFTANRFSPAAPTTVSSERNAPPYPSAPTRPTPPTVQTSSSAA 377

  Fly   473 GNTSESSVVVEPPKK 487
            ...|...|..:|.||
pombe   378 PVDSAEPVAYQPIKK 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 28/83 (34%)
Tudor-knot 692..751 CDD:288553
sol1NP_595529.1 BRIGHT 189..277 CDD:128777 30/94 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1125758
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13964
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.