DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and rsc9

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_596197.1 Gene:rsc9 PomBaseID:SPBC1703.02 Length:780 Species:Schizosaccharomyces pombe

Alignment Length:348 Identity:79/349 (23%)
Similarity:147/349 (42%) Gaps:60/349 (17%)


  Fly   296 EKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVT-SQNQWKLIAMRLGF 359
            |.|.|::.:..:..:||.|::..|.|..:.:.||.|::.|.|||||:.|: :::.|..||.....
pombe    22 ENDSFLSLIESFSQERGVPIDINPKIGRKPILLYELYKKVIKRGGYDAVSATEDGWTNIAEEFNQ 86

  Fly   360 TPCTVSVMNLVKQAYKKFL---QPYGDFHRKL-GCSMLMTSRNSNRSKGRSLVRANSVASPKP-- 418
            :....|. .:::..|.|:|   :.:..:|..| ..|.|..|.|......|..| .||.:.|||  
pombe    87 SDPARSA-GILQNVYFKYLISWEIHDHWHLLLPPPSTLELSENRQNVLERVKV-FNSCSPPKPTN 149

  Fly   419 ----METMKTETISK----LAQPNQTN-----VVASTSSSAAA--------ASVAASSTPAR--A 460
                ::..||.:..|    |.:.::.|     :..:.:|||:.        ||....|.|..  .
pombe   150 PITIIDNDKTHSFKKFYKSLVKEDEENGIEKKINEAMNSSASQPLPNSTNFASTTFPSVPFHPLP 214

  Fly   461 VSTASQSAAEESGNTSESSV---VVEPPKKQRKGSAASSQQGK---------VKSLVEKYEE-KS 512
            |.:..|...:.:.|.:..::   |..||...|...|..|||.|         :|...|:::| |.
pombe   215 VDSGLQKYIDRNSNLTPPALGAGVPGPPLLVRVALALKSQQDKEVDWAIGHLIKISFERHQEFKL 279

  Fly   513 TAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLS---SATSGGSATIATTAMNKD-----AE 569
            ..:.:.:...|...|...      |.:...|..|::|   ....|.:..:..:.::.:     |:
pombe   280 ERLPSLAECLVYSLGFQV------TKAKQVSDLTDISLCMDRAIGIALVLRNSVLSVENAKHVAQ 338

  Fly   570 SDLPLAKIKAAAVAAASTRHSME 592
            :.|.::.:: |::..|.|.:::|
pombe   339 TKLVISVLE-ASIRCAKTFNNLE 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 23/86 (27%)
Tudor-knot 692..751 CDD:288553
rsc9NP_596197.1 BRIGHT 21..113 CDD:128777 25/92 (27%)
ARM <388..451 CDD:237987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13964
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.