DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid4a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001074664.1 Gene:Arid4a MGIID:2444354 Length:1261 Species:Mus musculus

Alignment Length:1648 Identity:402/1649 (24%)
Similarity:603/1649 (37%) Gaps:483/1649 (29%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:..|:|..|.|||:|||||:|||||||:..|.|.:||||..||...:.:|.||.:|.|   |||
Mouse     1 MKAADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVLLKQDNTTQLVQDDQVKGP---LRV 62

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            ||:||.|..| ..:.||.|:|:.|.|.|||||||||..|||||:||||..|||.|||||||||||
Mouse    63 GAIVETRTSD-GSIQEAIISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETLDQLPLT 126

  Fly   131 HPEHFGNPVVGGR--RGRR------RGHLNEDSSEDDDESDAKEVVNEKEENIGKVVCVETESKK 187
            :|||||.||:..:  ||||      .....|:|||::||.  |..:|  :|.:||||.|.:.:  
Mouse   127 NPEHFGTPVIAKKTNRGRRSSLPITEDEKEEESSEEEDED--KRRLN--DELLGKVVSVASTA-- 185

  Fly   188 KDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDV---PAV 249
             :...|:|||||:|:....|.:: ||:.|||||.|.::|::.:|:..|.......:.::   |.:
Mouse   186 -ESTGWYPALVVSPSCNDDVTVK-KDQCLVRSFIDSKFYSIARKDIKELDILTLPESELCARPGL 248

  Fly   250 QAALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPH-----------------EEK 297
            :.|..||...::|.:|..|....|.:.||||| |..::..::|..                 ||:
Mouse   249 RRASVFLKGRIVPDNWKMDISEILESSSSDDE-ECPAEEHEEEKEKEAKKEEEELPEEELDPEER 312

  Fly   298 DRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPC 362
            |.|:.||||:|:|||||:||.|.:..:|::|::|||.|..:||...:.|...||.|.|.||....
Mouse   313 DNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYHQGGCGNIDSGAVWKQIYMDLGIPIL 377

  Fly   363 TVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETI 427
            ..:....||.||:|:|..:.::.|......                |......||..|..|    
Mouse   378 NSAASYNVKTAYRKYLYGFEEYCRSANIQF----------------RTIHHHEPKVKEEKK---- 422

  Fly   428 SKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGS 492
                         ....|...|...|...|...|.:..:...:.:..:......::.|:.:||  
Mouse   423 -------------DFEDSMDEALKEAPEMPLLDVKSEPEENTDSNSESDREDTELKSPRGRRK-- 472

  Fly   493 AASSQQGKVKSLV--EKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGG 555
             .......:|..:  ||.|:|                                            
Mouse   473 -IVRDANCIKKEIEEEKIEDK-------------------------------------------- 492

  Fly   556 SATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDA 620
              .:.....||||..|      ......||...|                       |:...|.:
Mouse   493 --FLRDDLENKDAGDD------DDDGDPAAKREH-----------------------ELLFGRKS 526

  Fly   621 SPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKI 685
            :|                      .||::|.:  |..|.|:|.|:||:::...:..:.:...|..
Mouse   527 TP----------------------KNKEKKIK--KPEDSERDSDEEEEKSQEREETESRCDSEGE 567

  Fly   686 DTGDFVVG--IGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVPR 748
            |..|....  .|.|:||.|...|:.    ..|||.:....:..|..:|||||.|||.||||||..
Mouse   568 DEEDDTEPCLTGTKVKVKYGRGKTQ----KIYEASIKSTEMDDGEILYLVHYYGWNVRYDEWVKA 628

  Fly   749 ERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGK 813
            :||...|.||..:|.:.....:...                                 |:|...:
Mouse   629 DRIIWPLDKGGPKKKQKKKVKNKED---------------------------------SEKDEKR 660

  Fly   814 DGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAKRGRGRSDSMPPRSTTPS 878
            |       .....:..|.|.|..:.     :|::..::.||      ....|:|||....|....
Mouse   661 D-------EERQKSKRGRPPLKSTF-----SPNMPYSLSKT------SNSEGKSDSCSSDSEADD 707

  Fly   879 SVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKRQSA 943
            .:...||...    ..|.::::::|                     :|:..|.......||....
Mouse   708 QLEKSSGGED----LSPDVKEELEK---------------------NENAHDDKLDEENPKIVHI 747

  Fly   944 KDKPQAGKAQPPGKGRLASSASSTAPAAHPSDDSEEDEEE-----EEPSAARAASSKQQQQQASS 1003
            ..:....:|||  ...|...|..:....|...|..:..||     |:....:...||.:......
Mouse   748 SKENDRTQAQP--SDTLTVEAGDSDQIVHIFGDKVDQVEEFKKQVEKSPKGKGRRSKTKDLSLEL 810

  Fly  1004 LRGSRAGGNRAMSSGAASAKGRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEPAL- 1067
            ::.|..|...|    .:.|.|..:.|.....|.|.|        :|.|:..|..:||...:..: 
Mouse   811 IKISPFGQEEA----GSEAHGDVHSLEFSSLECKNF--------SSTEDDIDPYEKEKKLKRKIL 863

  Fly  1068 --QDIKKEPKLESSAKSSSTELSSE--TESYADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHE 1128
              |..:|:.:|::..: .:|.:|.|  .:....|..:.:...:..:..|.|....||.|.:...|
Mouse   864 GQQSPEKKLRLDNGME-MTTGVSQERSDDGAGAEGMKGAHVEQHFETEGEGMPSLTAEPDQGLQE 927

  Fly  1129 PVTKRELAVKEEPLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSS 1193
            ..:::    .:.|.:.||...|.:||..:.|           ||.|.                  
Mouse   928 LTSEK----SDSPAEEEPVHTPLKEEEDAMP-----------LIGPE------------------ 959

  Fly  1194 TTAKYTSVIVE---KPLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQESKKFAEPVA 1255
                 |.|..|   ..|....|.|:|..|.:.:|              |:|.||           
Mouse   960 -----TLVCHEVDLDDLDEKDKTSIEDVVVEGSE--------------SNSLAS----------- 994

  Fly  1256 SLKVEMPAACSPSSSSSSSSSFCSTGSAVSSSSATRSLPDMSKLEISSGTVPGATPGAAALQPSN 1320
                 :|.|..|    .:..:|........|...:||:...|.:.|               :..:
Mouse   995 -----VPPALPP----VAQHNFSVASPLTLSQDESRSIKSESDITI---------------EVDS 1035

  Fly  1321 VAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEFKDTEPFEFEKRISPMASVGGTVAAA 1385
            :|:.|..|..:  :.|::|                            ||                
Mouse  1036 IAEESQEGLCE--RESANG----------------------------FE---------------- 1054

  Fly  1386 ATAAGAMAAAGAASVITTMVPT-------PGASGSGVAASASTSAPVVVGSAARKQALKASAIQH 1443
                 |..|:||.|:|.....:       |....||:.|......|....:||:.:  |..|.|.
Mouse  1055 -----ASVASGACSIIAHERESREKGQKRPSDGNSGLIAKKQKRTPKRTSAAAKTE--KNGAGQS 1112

  Fly  1444 ILEHQSPAAGRERGGYGGMTSS-----ISLLTAPKLKK------RGSP-LKEAALCMEKAK---- 1492
            ......||          |.||     :..||.||.:|      |.|| :|:|    ||.|    
Mouse  1113 SDSEDLPA----------MDSSSNCTPVKRLTLPKSQKLPRSPARTSPHIKDA----EKEKHREK 1163

  Fly  1493 -------TYK-------LDKDQVQQPVE--QKTQQLIQPTLGPVESYGAGSPEAMSNLSTPTTSS 1541
                   |||       ||.....:.:.  |:..|.|:.....::|..|........|.......
Mouse  1164 HPNSSPRTYKWSFQLNELDNMNSTERISFLQEKLQEIRKYYMSLKSEVATIDRRRKRLKKKDREV 1228

  Fly  1542 GHAQLSASSTYSQ--LTPHHATP 1562
            .||..|.||..|.  ::|..::|
Mouse  1229 SHAGASMSSASSDTGMSPSSSSP 1251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 29/94 (31%)
ARID 299..381 CDD:279697 35/82 (43%)
Tudor-knot 692..751 CDD:288553 25/61 (41%)
Arid4aNP_001074664.1 DNA-binding. {ECO:0000250|UniProtKB:P29374} 4..121 72/121 (60%)
TUDOR 58..113 CDD:197660 35/59 (59%)
RBB1NT 175..261 CDD:311890 28/90 (31%)
BRIGHT 312..401 CDD:128777 36/89 (40%)
Chromodomain-like. {ECO:0000250|UniProtKB:P29374} 571..638 29/71 (41%)
Tudor-knot 578..632 CDD:314560 26/58 (45%)
Rabaptin <778..937 CDD:308892 34/176 (19%)
Retinoblastoma protein binding. {ECO:0000250|UniProtKB:P29374} 955..968 6/36 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104880154
eggNOG 1 0.900 E1_KOG2744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 423 1.000 Inparanoid score I1746
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 1 1.000 T616969
orthoMCL 1 0.900 OOG5_131238
Panther 1 1.100 LDO PTHR13964
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
109.870

Return to query results.
Submit another query.