DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and RBM34

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 HGNCID:28965 Length:430 Species:Homo sapiens

Alignment Length:460 Identity:92/461 (20%)
Similarity:149/461 (32%) Gaps:133/461 (29%)


  Fly   858 GGAKRGRGRS--------DSM---PPRSTTPSSVVA-------HS----GRTKSPAAS-QPQLQQ 899
            |.:||.|.||        |.:   ||.......|.:       ||    ||..|..:| :||:|.
Human     5 GMSKRKRKRSVQEGENPDDGVRGSPPEDYRLGQVASSLFRGEHHSRGGTGRLASLFSSLEPQIQP 69

  Fly   900 QMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQAGKAQPPGKGRLASSA 964
            .....|.:.:..|           ....:.:|...:.||..|....|.:|.|.....:.:||...
Human    70 VYVPVPKQTIKKT-----------KRNEEEESTSQIERPLSQEPAKKVKAKKKHTNAEKKLADRE 123

  Fly   965 SSTAPAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAM--SSGAASAKGRDY 1027
            |:.|.|         |.|||       ...||.|::.:|..|.:....:.:  :.....::.:..
Human   124 SALASA---------DLEEE-------IHQKQGQKRKNSQPGVKVADRKILDDTEDTVVSQRKKI 172

  Fly  1028 DLSEIRSELKGFQPKLLTN--AASNEER----------------KDLAKKEPSDEPALQDIKKEP 1074
            .:::....||..:...:.|  ...|:::                :.|...|.:....|..||:  
Human   173 QINQEEERLKNERTVFVGNLPVTCNKKKLKSFFKEYGQIESVRFRSLIPAEGTLSKKLAAIKR-- 235

  Fly  1075 KLESSAKSSSTELSSETESYADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVT--KRELAV 1137
            |:....|:.:..:..:.||.|.:         .||.:||...:.......|..|..:  ||.:.|
Human   236 KIHPDQKNINAYVVFKEESAATQ---------ALKRNGAQIADGFRIRVDLASETSSRDKRSVFV 291

  Fly  1138 KEEPLKIEPKTEPKEEETKSKPFLSGADIKPTALIAP-----------ARFGNTSAAQAASSSGS 1191
            ...|.|:       ||....|.||....|....::..           ..|.||.:...|....:
Human   292 GNLPYKV-------EESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFENTDSVHLALKLNN 349

  Fly  1192 SSTTAKYTSVI-------------------VEKP-----LTIGGKKSVEQH-----VPKKAELLK 1227
            |....:...|:                   |.||     .|   .|:.|.|     :.:||.|||
Human   350 SELMGRKLRVMRSVNKEKFKQQNSNPRLKNVSKPKQGLNFT---SKTAEGHPKSLFIGEKAVLLK 411

  Fly  1228 KQSGG 1232
            .:..|
Human   412 TKKKG 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553
RBM34NP_055829.2 RRM 176..>382 CDD:223796 38/224 (17%)
RRM1_RBM34 185..276 CDD:240840 16/102 (16%)
RRM2_RBM34 288..360 CDD:240841 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104861945
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.