DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid5a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001277655.1 Gene:Arid5a MGIID:2443039 Length:619 Species:Mus musculus

Alignment Length:688 Identity:132/689 (19%)
Similarity:218/689 (32%) Gaps:199/689 (29%)


  Fly   275 NISSDDEGEID----SDSSDDE------------------PHEEKDRFVAQLYKYMDDRGTPLNK 317
            |....:||::.    |...|||                  ..||:..|:..|||:|.:|.||:.:
Mouse    38 NTEQSEEGDLPQLPVSPKPDDEQSRSQSPTQLQDSPEAGGEQEEEQAFLVSLYKFMKERHTPIER 102

  Fly   318 VPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYG 382
            ||.:..:.::|:::::||:|.|.|..||.:..||.:...||.:|.:.|.....::.|::.:.|| 
Mouse   103 VPHLGFKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGGSPGSTSAATCTRRHYERLVLPY- 166

  Fly   383 DFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMK-----------------TETISKL 430
                                     ||.......||:...|                 ||.:.|.
Mouse   167 -------------------------VRHLKGEDDKPLPPTKPRKQYKMAKELRGDDGTTEKLKKA 206

  Fly   431 AQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAAS 495
            ....:..|..:|.....:.:...:..|.:.   :|:.:.|:.|..|..|    ||.     :.||
Mouse   207 KDSEERRVEQTTPGKTKSDATGQTQLPCQG---SSRDSTEQLGPVSGPS----PPL-----TGAS 259

  Fly   496 SQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIA 560
            |.....|.|:..:..|             |:....|..|.....|..|.|..|.....|  ....
Mouse   260 SCPEAYKRLLSSFYCK-------------GAHGIMSPLAKKKLLAQVSKAEALQCQEEG--CRHG 309

  Fly   561 TTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDASPSVA 625
            ..:.|||.: |.| ..::..|       .:.|.:.....|..|...|....|::      .|...
Mouse   310 ARSPNKDIQ-DSP-QNLRGPA-------ENSEHQLTPREGLQAPGGSTRMEAQV------GPCPT 359

  Fly   626 APPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKIDTGDF 690
            ||..:|...:......:..|    :|.|                                   ||
Mouse   360 APMFSGCFHAYPTEVLKPVS----QHPR-----------------------------------DF 385

  Fly   691 VVGIGDKLKVNYHEKK-------------SPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRY 742
            ..|:.|::.:....|:             ..::|.|.:         .:|           :.|.
Mouse   386 FSGLKDRVLLGPPGKEEGPTTKESHLVWGGDANHPSAF---------HKG-----------STRK 430

  Fly   743 DEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVS 807
            ..:.|:.: |..::..:|..|......|.:..|.|.|...|....|...||..|.........|.
Mouse   431 RSFYPKPK-ACWVSPMAKVPTERPGAPSPHPSSPGLGSKRGLEEEGFAHGGKKLRAVSPFLKEVD 494

  Fly   808 DKQPGKDGCSKMSPSSGNSTGPG--APSLSGSLGGASSTPSLLSTVVKTPP--TGGAKRGRGRSD 868
            .|:.|           |....||  ...|.|...|.:...:...|:::.|.  ||.|...:|:: 
Mouse   495 SKETG-----------GKPAAPGLAVSCLLGPTPGPTPPEAYRGTMLRCPLNFTGSADPLKGQA- 547

  Fly   869 SMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPT 906
            |:|   .:|..:.|......:...|.|.....|...||
Mouse   548 SLP---FSPLVIPAFPAHLLATTGSSPMAASLMHFPPT 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 26/82 (32%)
Tudor-knot 692..751 CDD:288553 8/72 (11%)
Arid5aNP_001277655.1 BRIGHT 85..172 CDD:128777 29/113 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104870403
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.