DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and ARID2

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_689854.2 Gene:ARID2 HGNCID:18037 Length:1835 Species:Homo sapiens

Alignment Length:2359 Identity:404/2360 (17%)
Similarity:677/2360 (29%) Gaps:844/2360 (36%)


  Fly   286 SDSSDDEPHEEKDR---FVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQ 347
            ::|:...|.:|:.:   |:.:|.::...||:|..|:|::..:::||:.|:..|...||:.:|:.:
Human     2 ANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEK 66

  Fly   348 NQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFH--------------------------- 385
            |||..|.....|.....:....:||.|.::|:.|...|                           
Human    67 NQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKPQLPIGAIPSSY 131

  Fly   386 ------------RKLGCSMLMTSRNSNRSKGRSLVRA--NSV------------ASPKPMETMKT 424
                        :..|.||...|.|.......||:..  |.|            .|...|:..|.
Human   132 NYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVCTLLSNESKHVMQLEKD 196

  Fly   425 ETISKLAQPNQTNVVASTSSSAAAA------------------SVAASSTPARAVSTASQSAAEE 471
            ..|..|...| ..|...|..|.:..                  .:...:.....:|..::|....
Human   197 PKIITLLLAN-AGVFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDIVDDNEVRDLISDRNKSHEGT 260

  Fly   472 SGNTSESSVVVEPPKK--------QRKGSAA------SSQQGKVKSLVEK--------YEEKSTA 514
            ||.....| :..||:|        ||....|      |.::|.||.|...        ....|..
Human   261 SGEWIWES-LFHPPRKLGINDIEGQRVLQIAVILRNLSFEEGNVKLLAANRTCLRFLLLSAHSHF 324

  Fly   515 VQATSSGTVAGSGASASAAAMP----TTSAAASTAT-------------------NLSSATSGGS 556
            :.....|.......:|.....|    ||.....|.|                   ||..|...| 
Human   325 ISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSRDRFLKMRGMEILGNLCKAEDNG- 388

  Fly   557 ATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDAS 621
             .:....:::|:..::.........:...||...:...|.:...:....:....|.:|       
Human   389 -VLICEYVDQDSYREIICHLTLPDVLLVISTLEVLYMLTEMGDVACTKIAKVEKSIDM------- 445

  Fly   622 PSVAAPPSAGASTSG--AAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEK 684
              :....|......|  |.|..:...:....||...:...:                    ::|:
Human   446 --LVCLVSMDIQMFGPDALAAVKLIEHPSSSHQMLSEIRPQ--------------------AIEQ 488

  Fly   685 IDTGDFVVGI-GDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVP- 747
            :.|...|... ..:..|..|....|.         ::||..::       ....|.|.:.|..| 
Human   489 VQTQTHVASAPASRAVVAQHVAPPPG---------IVEIDSEK-------FACQWLNAHFEVNPD 537

  Fly   748 -----RERIAENLTKGSKQKTRTISTSSA------------------NSGSGGGGGGGGGGGGGG 789
                 .|..:|.|:..||.....|.||:.                  :|.|              
Human   538 CSVSRAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSSS-------------- 588

  Fly   790 GGGGGSLLVQG--------------SQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSLSGSLGG 840
             .|...:.|.|              .|.| ||......|....:||:...:   |.|..|.::|.
Human   589 -NGQAHIHVVGVKRRAIPLPIQMYYQQQP-VSTSVVRVDSVPDVSPAPSPA---GIPHGSQTIGN 648

  Fly   841 -------ASSTPSLLSTVVKTPPTGGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQ 898
                   |:.:.:|.:|.:..|..|              ..|...:|      ::.|....|...
Human   649 HFQRTPVANQSSNLTATQMSFPVQG--------------VHTVAQTV------SRIPQNPSPHTH 693

  Fly   899 QQMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQAGKAQPPGKGRLASS 963
            ||.....|.:......|..|..|::...|...:..||                            
Human   694 QQQNAPVTVIQSKAPIPCEVVKATVIQNSIPQTGVPV---------------------------- 730

  Fly   964 ASSTAPAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGRDYD 1028
              |.|....|...|........|......:|:......|.:.                      .
Human   731 --SIAVGGGPPQSSVVQNHSTGPQPVTVVNSQTLLHHPSVIP----------------------Q 771

  Fly  1029 LSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTELSSETES 1093
            .|.:.:.:.|                    :.||..|.....:..|:.....:..:....:.|.|
Human   772 QSPLHTVVPG--------------------QIPSGTPVTVIQQAVPQSHMFGRVQNIPACTSTVS 816

  Fly  1094 YADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETKSK 1158
                               .|::..|.||     :||                       :|.|:
Human   817 -------------------QGQQLITTSP-----QPV-----------------------QTSSQ 834

  Fly  1159 PFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVE------Q 1217
            ...:|:..:.|.:|||.::..|||:...     |:|:.:...|...:.:||.|..|.:      |
Human   835 QTSAGSQSQDTVIIAPPQYVTTSASNIV-----SATSVQNFQVATGQMVTIAGVPSPQASRVGFQ 894

  Fly  1218 HVPKK------------AELLKKQSGGAGGTAASSSAASQESKKFAEPVASLKVEMPAACSPSSS 1270
            ::..|            .:.:::.......:....|..:|:.:.:|..:..:.:..|||.....:
Human   895 NIAPKPLPSQQVSSTVVQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLANPAALPAGQT 959

  Fly  1271 -----------SSSSSSFCSTGSAVSSSSATRSLPDMSKLEISSGTVPGATPGAAALQPSNVAQV 1324
                       |||.|...:|.:.|.::.::.|.|.      |.|            .|..|:|:
Human   960 VQLTGQPNITPSSSPSPVPATNNQVPTAMSSSSTPQ------SQG------------PPPTVSQM 1006

  Fly  1325 SSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEFKDTEPFEFEKRISPMASVGGTVAAAATAA 1389
            .|....::.::|.:.              .....:.:..:|.:.:.::.|..|..|.        
Human  1007 LSVKRQQQQQHSPAP--------------PPQQVQVQVQQPQQVQMQVQPQQSNAGV-------- 1049

  Fly  1390 GAMAAAGAASVI-TTMVPTPGASGSG-----------VAASASTSAPVVVGSAARKQALKASAIQ 1442
             ...|:|.:|:| ..::|..|.|..|           ...:|...:|.||...|..||       
Human  1050 -GQPASGESSLIKQLLLPKRGPSTPGGKLILPAPQIPPPNNARAPSPQVVYQVASNQA------- 1106

  Fly  1443 HILEHQSPAAGRERGGYG--GMTSSISLLTAPKLKKRGSPLKEAALCMEKAKTYKLDKDQVQQPV 1505
                          .|:|  |.|.:..||                                   |
Human  1107 --------------AGFGVQGQTPAQQLL-----------------------------------V 1122

  Fly  1506 EQKTQQLIQPTLGPVESYGAGSPEAMSNLST---PTTSSGHAQLSASSTYSQLTPHHATPFDALR 1567
            .|:..||:...:.|   .|......:|||..   |..|:..|.:...::.:|:|           
Human  1123 GQQNVQLVPSAMPP---SGGVQTVPISNLQILPGPLISNSPATIFQGTSGNQVT----------- 1173

  Fly  1568 KSPSFNLNITALNEELAQTVQETTRALTDALQPPSTPVPPTVSASGSTPTAVTPV-ITAMPTAGT 1631
                    ||.:                     |:|...|...:.|:....:.|. ||...|...
Human  1174 --------ITVV---------------------PNTSFAPATVSQGNATQLIAPAGITMSGTQTG 1209

  Fly  1632 AGLSCPSTPPTGANPV-LASPKLSTPP---QAINASKQPPASHIVGSPFIETR-NVFELSTSNEG 1691
            .||...:.|.|.|:|. .:|...:|||   ..|...|:..|....|....|.: .|.|..:...|
Human  1210 VGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEAKEATGLHVHERKIEVMENPSCRRG 1274

  Fly  1692 -SGYSSGESKDNKFEKLENVKILLAGAVGPFDLDAGSYEQKTSSIADKVLKAISQKKEEVENNKG 1755
             :..|:|::|:|:.    :|..||.|                ...:|..|...:..|.:.|.|: 
Human  1275 ATNTSNGDTKENEM----HVGSLLNG----------------RKYSDSSLPPSNSGKIQSETNQ- 1318

  Fly  1756 KPPVEPAAAAKTPGREDVVPSPTAKLDLCSSAIKLDTLKLLSEPLKIQTGPLLGELYRPGPATSS 1820
                                        ||               .|..||.| ||...|     
Human  1319 ----------------------------CS---------------LISNGPSL-ELGENG----- 1334

  Fly  1821 PETKSILESSLPAKNSELSETIQKLECAIQQRKTPVGGALSLASSTAGTPPTAHTPNSTATAGAG 1885
                        |...:.||.|...:.....||..|.|........ |:..:.:.||        
Human  1335 ------------ASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGD-GSHLSKNIPN-------- 1378

  Fly  1886 FSDESMDSTDSEQRLVIEDVIAEEHTTTTTTGE-QKSPGSQQEEGQTNTATMATAVTAETEGTSS 1949
                                    |.|:...|. :.||  .:.:|..:.....||...:.|..|:
Human  1379 ------------------------HKTSNHVGNGEISP--MEPQGTLDITQQDTAKGDQLERISN 1417

  Fly  1950 STPTPPVPAPVKLELGAKAMPGIQAPIPLKPAEGSSFAGKLTGVVQPPPLAKLQQQEELGQAQGQ 2014
                    .|| |.||..::..||   ....|....|:|  |.::..|..:.|.     .....|
Human  1418 --------GPV-LTLGGSSVSSIQ---EASNAATQQFSG--TDLLNGPLASSLN-----SDVPQQ 1463

  Fly  2015 SKSISSFGIPIVLPEIPASVVVATPALMVASAATVMRHSP-------GSTPNSQAPVLISP---- 2068
            ..|:      :|.|....||:.....:.|..:.:.:.|||       .:...::...:..|    
Human  1464 RPSV------VVSPHSTTSVIQGHQIIAVPDSGSKVSHSPALSSDVRSTNGTAECKTVKRPAEDT 1522

  Fly  2069 --KTFLTAP-KVGEVGGLLLKAYT-------GVSGAVGAAPAG---SVIASAGGGGTPTVISNFP 2120
              :|....| |||      ::..|       |.|..:.|.|||   |.:|.       ..|.:..
Human  1523 DRETVAGIPNKVG------VRIVTISDPNNAGCSATMVAVPAGADPSTVAK-------VAIESAV 1574

  Fly  2121 QQQQQ------ASVLQASSEMPANYVLDAEMAEPSNSSAPVVARPFVMHAVGKELFNVVAPAASS 2179
            ||:||      .:|:..::.||.:..:..: .:| |||.|                   :|.:.|
Human  1575 QQKQQHPPTYVQNVVPQNTPMPPSPAVQVQ-GQP-NSSQP-------------------SPFSGS 1618

  Fly  2180 PLISDP-HNESINLLC-----------EETIPGSPAPNYGGTDQLPTAVNSALAIVGITPL---- 2228
            ....|| .....|.:|           ...:....|..:||.|..|    ......|..|.    
Human  1619 SQPGDPMRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYP----GQCLWEGCEPFQRQR 1679

  Fly  2229 --------PPDTPPPVPVAAIQQQQQHQLQSGQQQQAAKTGEVNPSGPNSSPDSASQDESGEEAK 2285
                    .........:|.::|.:..  |:|.|:.:.|...|  .|.:|:|          .|:
Human  1680 FSFITHLQDKHCSKDALLAGLKQDEPG--QAGSQKSSTKQPTV--GGTSSTP----------RAQ 1730

  Fly  2286 KNAGLEHEDSTGLGALNKRKRN--------RKPLPMSAQTAAAVAAQLQSLGK---------RRR 2333
            |  .:.:..|..|.||.:..||        .|..|::.......|..|:::||         :|.
Human  1731 K--AIVNHPSAALMALRRGSRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRH 1793

  Fly  2334 Q----VSGMRNQKTTTTAA 2348
            :    |..:.|.:.::|.|
Human  1794 ENNLSVLAISNMEASSTLA 1812

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 23/85 (27%)
Tudor-knot 692..751 CDD:288553 10/66 (15%)
ARID2NP_689854.2 ARID 19..101 CDD:279697 24/82 (29%)
LXXLL 313..317 0/4 (0%)
RFX_DNA_binding 521..601 CDD:280427 17/102 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.