DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and cfi-1

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_492644.2 Gene:cfi-1 WormBaseID:WBGene00000476 Length:467 Species:Caenorhabditis elegans

Alignment Length:535 Identity:104/536 (19%)
Similarity:166/536 (31%) Gaps:201/536 (38%)


  Fly   151 LNEDSSEDDDESDAKEVVNEKEENIGKVVCVETESKKKDKEKWFPALVVAPTAQATVRIRVKDEY 215
            :|.....||..|:..|.|::           :||.:|..     ||     :...|..:.|.|  
 Worm    23 VNVGGHHDDSSSNCDERVDD-----------QTEEQKSP-----PA-----SPDLTANLNVFD-- 64

  Fly   216 LVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQAALEF-LDSSVLPAHWDRDSLF-------- 271
                                    :.|:|.|  ||..|.. |:.|.|.|..:...:|        
 Worm    65 ------------------------LESRQKV--VQRLLNSQLNLSNLRAPLNLPPIFQALQGPFS 103

  Fly   272 ----------GLTNISS-----DDEGEIDSDSSD--------------DEPHEE----------- 296
                      |||.||.     |:|.....:..|              :||.|.           
 Worm   104 IQQQLLGLASGLTAISPGLDDYDEENTNQGEPEDLTLGGFRKETSVKSEEPSESGINASGPAWSY 168

  Fly   297 KDRFVAQLYKYMDD----------------RGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVT 345
            :::| .|||:..||                .|.|:.::|.:..:.:|||.|:|.|.:.||...:.
 Worm   169 EEQF-KQLYELSDDVKRKEWLDDWLNFMHRIGKPVTRIPIMAKQVLDLYELYRLVVQHGGLVEII 232

  Fly   346 SQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKL-GCSMLMTSRNSNRSKGRSLVR 409
            ::..|:.|...|.......|....::..|:|:|..|.....|| ..|.|..:.:.||.:...  |
 Worm   233 NKKLWREITKGLNLPSSITSAAFTLRTQYQKYLYDYECEKEKLSNQSDLQQAIDGNRREAPG--R 295

  Fly   410 ANSVASPKPME---------TMKTETISKLAQPN----QTNVVASTSSSAAAASVAASSTPARAV 461
            ..:.:.|.|.:         ||....::.|...|    ..|.::..:|.....|..|..   .|:
 Worm   296 RTAPSFPLPFQLPHAASAAATMLNNQLNGLGMRNDLLDDENTLSLQASGLFGTSYGAEQ---MAI 357

  Fly   462 STASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGS 526
            ..|.|...|.:                         |..|:..|.:.....||....:.|.:..|
 Worm   358 LEAHQRNLERA-------------------------QRAVQQQVARQSLGLTACSNGNGGNIHNS 397

  Fly   527 GASASAAAMPTTSAAASTATNLSSATSGGSATIATTAMNKDAESDLPL--------AKIKAAAVA 583
            |..             ||::|                     :||:|.        .|...|:..
 Worm   398 GRE-------------STSSN---------------------DSDIPAKRPKLENDVKTNGASSM 428

  Fly   584 AASTRHSMEKETNIS 598
            ..||:||...:|::|
 Worm   429 RISTKHSDNSKTSMS 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 17/92 (18%)
ARID 299..381 CDD:279697 24/98 (24%)
Tudor-knot 692..751 CDD:288553
cfi-1NP_492644.2 ARID 183..269 CDD:198082 19/86 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.