DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and ARID3A

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_005215.1 Gene:ARID3A HGNCID:3031 Length:593 Species:Homo sapiens

Alignment Length:812 Identity:167/813 (21%)
Similarity:263/813 (32%) Gaps:284/813 (35%)


  Fly    54 DAIKAPTGQLRVGAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHF 118
            |...||.|:.| .|..|.|.|:...:..|.:..               :..:|..|..|  |...
Human    30 DPPAAPPGRAR-AAPDEDREPESARMQRAQMAA---------------LAAMRAAAAGL--GHPA 76

  Fly   119 NESETLDQLPLTHPEHF------GNPVVG-GRRGRRRGHLNEDSSEDDD----------ESDAKE 166
            :...:.|..|.:..|..      |:|  | ||.|....|. ||.:.|:|          |.|..|
Human    77 SPGGSEDGPPGSEEEDAAREGTPGSP--GRGREGPGEEHF-EDMASDEDMKPKWEEEEMEEDLGE 138

  Fly   167 VVNEKEENIGKVVCVETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFK-DGRYYTVPK 230
            ...|:||:      .|.|.:::|:|...|.   .|.:..|..:..:.....::|: ||    ||:
Human   139 DEEEEEED------YEDEEEEEDEEGLGPP---GPASLGTTALFPRKAQPPQAFRGDG----VPR 190

  Fly   231 KEATEFTREVASKQDVPAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDEG------------E 283
                     |...|:.|....|.....:.|.|            .:...|.|            |
Human   191 ---------VLGGQERPGPGPAHPGGAAHVAP------------QLQPPDHGDWTYEEQFKQLYE 234

  Fly   284 IDSDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQN 348
            :|.|       .::..|:..|:.:|..||||:|::|.:..:.:||:.|:..|.::||...|.::.
Human   235 LDGD-------PKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKK 292

  Fly   349 QWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKL-GCSMLMTSRNSNRSKGRSLVRANS 412
            .|:.|...|.......|....::..|.|:|.||....|.| ..:.|..:.:|||.:||......|
Human   293 LWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGS 357

  Fly   413 VASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSE 477
            :.:..|                             ..:....|:|...||:...:|     :|:.
Human   358 LFAYSP-----------------------------GGAHGMLSSPKLPVSSLGLAA-----STNG 388

  Fly   478 SSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAA 542
            ||:...|               |:|      :|:.:|:..|..|.:     ..|.|..|..:|  
Human   389 SSITPAP---------------KIK------KEEDSAIPITVPGRL-----PVSLAGHPVVAA-- 425

  Fly   543 STATNLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASS 607
                                               :||||.||                :|.|:.
Human   426 -----------------------------------QAAAVQAA----------------AAQAAV 439

  Fly   608 KANSAEMQRSRDASPSVAAPPSAGASTSGAAATAQTASNKK-----EKHQRSKQADKEKDKDKEE 667
            .|.:|.:::.|:...| |.||                 .||     ::.||..|...:::.....
Human   440 AAQAAALEQLREKLES-AEPP-----------------EKKMALVADEQQRLMQRALQQNFLAMA 486

  Fly   668 KQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYL 732
            .|.....|...:.|..:.|:...:.|                ::||.        |:...|.:..
Human   487 AQLPMSIRINSQASESRQDSAVNLTG----------------TNGSN--------SISMSVEING 527

  Fly   733 VHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLL 797
            :.|||                   ....|......||:.|.|.|||||.....||.||.      
Human   528 IMYTG-------------------VLFAQPPAPTPTSAPNKGGGGGGGSSSNAGGRGGN------ 567

  Fly   798 VQGSQPPGVSDKQPGKDGCSKMSPSSGNSTGP 829
                  .|.|..|.|..|.|..|.|:.|::.|
Human   568 ------TGTSGGQAGPAGLSTPSTSTSNNSLP 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 19/92 (21%)
ARID 299..381 CDD:279697 24/82 (29%)
Tudor-knot 692..751 CDD:288553 8/59 (14%)
ARID3ANP_005215.1 Acidic 119..156 11/43 (26%)
BRIGHT 239..331 CDD:128777 26/92 (28%)
Important for nuclear localization. {ECO:0000250} 445..488 10/61 (16%)
Homodimerization 490..513 4/39 (10%)
Important for cytoplasmic localization. {ECO:0000250} 537..557 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.