DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Msl3

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001357720.1 Gene:Msl3 MGIID:1341851 Length:525 Species:Mus musculus

Alignment Length:489 Identity:88/490 (18%)
Similarity:135/490 (28%) Gaps:185/490 (38%)


  Fly   698 LKVNYHE-------KKSPSSHGSTYEAKVIEISV-----QRGVPMYLVHYTGWNNRYDEWVPRER 750
            :|..:|.       :..|:.....|:||:|::.:     .|.:|.||:|:.|||..:|.|...|.
Mouse     7 MKFQFHSGEKVLCFEPDPTKARVLYDAKIIDVIIGKDEKGRKIPEYLIHFNGWNRSWDRWAAEEH 71

  Fly   751 IAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGKDG 815
            :..:..:..:.:.:....:.|.                         ::|:.......:.||.|.
Mouse    72 VLHDTDENRRLQRKLAKKAIAR-------------------------LRGTGKKKRRCRLPGVDS 111

  Fly   816 CSKMSP------SSGNSTGPGAPSLSGSLGG-------------ASSTPSLLS----------TV 851
            ..|..|      :..||.........|...|             |.:...:||          |:
Mouse   112 VLKSVPVKEKSKNDENSVSSTCHESCGEKNGGIKEHRQRRIKVKAKAKKKVLSLRSRKEMDERTI 176

  Fly   852 VKTPPTGGAKR---------GRGRSDSMPPRS---TTPSSVVAHSGRTKS--------------- 889
            ....|....|:         .|.|...:|.::   |...|.|.|.....:               
Mouse   177 TIDIPDVLKKQLEDDCYYINRRKRLVKLPCQTNIITILESYVKHFAINAAFSANERPRHHHAMMH 241

  Fly   890 --------PAASQPQL------------------------QQQMKKRPTR------VVPGTTTPR 916
                    ||.....|                        :|...||.|.      :...|||..
Mouse   242 THMNVHYVPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQTQYKRVTSSKFFLPIKESTTTTN 306

  Fly   917 RVSDASMASESDSDSDEPVRRPKRQSAKDKPQAGKAQPPGKGRLASSASSTAPAAHPSDDSEEDE 981
            |       |:.:.....|:..|      ..||:.::|||           |...|.|.      .
Mouse   307 R-------SQEELSPSPPLLNP------STPQSTESQPP-----------TGEPATPK------R 341

  Fly   982 EEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGRDYDLSEIRSELKGFQPKLLTN 1046
            .:.||.|.        |....|.|.|......:.||.:...|.|..|.|       ...|||..:
Mouse   342 RKAEPEAL--------QSLRRSTRHSTNCDRLSESSSSPQPKRRQQDTS-------ASMPKLFLH 391

  Fly  1047 AASNEERKDLAKKEPSDEPALQDIKKEPKLESSA 1080
                     |.||.|....:...|...|..:.||
Mouse   392 ---------LEKKTPVHSRSSSPIPLTPSKDGSA 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 18/65 (28%)
Msl3NP_001357720.1 Required for the histone acetyltransferase activity of the MSL complex. {ECO:0000250} 294..444 39/178 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.