DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and cec-7

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001022827.1 Gene:cec-7 WormBaseID:WBGene00012551 Length:499 Species:Caenorhabditis elegans

Alignment Length:409 Identity:105/410 (26%)
Similarity:152/410 (37%) Gaps:83/410 (20%)


  Fly   425 ETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESS---VVVEPPK 486
            :|.|..|..|.|:  :..:..||.|..|.....|:.|..:|..||:......|||   :.|:||.
 Worm    94 QTASSSADSNGTS--SGATEKAAKAPAATMRKSAKKVDESSSEAADPKAKAEESSQNALKVDPPL 156

  Fly   487 KQRKGSAASSQ-QGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTS-----AAASTA 545
            ..||.|..::: .|.:|.|....|.:..|.:.|         ....|...|..|     |..|||
 Worm   157 TTRKSSRTTTEATGAMKRLTVAQETEDEAPKET---------VQKKARIEPVDSAEESKAKGSTA 212

  Fly   546 TNLSSATS-GGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSME-----KETNISSGSSAS 604
            ....||.. |.|.:.||....|..||.....|::.......|:|.::|     |...::..:...
 Worm   213 PMRKSAKKVGESNSEATDPEAKAKESSQSALKVEPPLTTHNSSRKTVEATGAMKRLTVAKETEDE 277

  Fly   605 ASSKANSAEMQRSRDASPS--VAAPPSA--------GASTSGAAAT-----AQTASNKKEKHQRS 654
            |......|.::...|||.:  .|||.||        .:||:.||.|     ...|...|.|...:
 Worm   278 ALKSQKKARIEPVEDASKAKGSAAPKSASSRAEDGESSSTNDAAGTRFVIGELVACTYKGKVYDA 342

  Fly   655 KQADKEKDKDKEEKQASSGK----RKKEKISVEKIDTGDFVVGIGD---------KLKVNYHEKK 706
            ...|.:.|||.:|......|    |..|:|.:.: :|.....||.|         :.....|||.
 Worm   343 VITDIKPDKDGKECYCIHFKGWNNRYDEQIPIGE-ETDRIFKGIADGYRAPVVTMRKSARNHEKS 406

  Fly   707 SP---------------------------SSHGSTYEAKVIEISVQR-GVPMYLVHYTGWNNRYD 743
            :.                           :.:|..|:|.:::|.... |...|.||:.|||:|||
 Worm   407 TEPQATKENAPRLVGKRREQFIIGEQVTCTQNGKPYDAYIVDIITDTDGKDFYCVHFKGWNSRYD 471

  Fly   744 EWVPRERIAENLTKGSKQK 762
            |.:|.......|.|||..|
 Worm   472 EKIPVGEEQGRLFKGSAAK 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 22/96 (23%)
cec-7NP_001022827.1 CHROMO 30..>56 CDD:214605
CHROMO 344..>374 CDD:214605 9/30 (30%)
Tudor-knot 427..476 CDD:288553 16/49 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.