DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and ARID3C

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_016869772.1 Gene:ARID3C HGNCID:21209 Length:562 Species:Homo sapiens

Alignment Length:339 Identity:83/340 (24%)
Similarity:123/340 (36%) Gaps:80/340 (24%)


  Fly   172 EENIGKVVCVETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEF 236
            |..:|.|...|.|..::|:||                               |.....::||.|.
Human   192 EGALGNVGAEEEEDAEEDEEK-------------------------------REEAGAEEEAAEE 225

  Fly   237 TREVASKQDVPAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRFV 301
            :|..|.....|:.|      ...:.|..|..:..|       ....|:|:|       .::..|:
Human   226 SRPGAQGPSSPSSQ------PPGLHPHEWTYEEQF-------KQLYELDAD-------PKRKEFL 270

  Fly   302 AQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSV 366
            ..|:.:|..||||:|:||.:..:.:|||.|||.|..:||...|.::..|:.:...|.......|.
Human   271 DDLFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSA 335

  Fly   367 MNLVKQAYKKFLQPYGDFHRKLGC-SMLMTSRNSNRSKGR----SLVRANSVASPKPMETMKTET 426
            ...::..|.|:|.||....|.|.. ..|..:.:|||.:||    :......:|.|.|........
Human   336 AFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTATPLFGLAGPPPRGAQDPAL 400

  Fly   427 ISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQS--AAEES---------------GN 474
            ....|.|       :|.||...|..:.|..||.|.:..|.|  ..|||               |.
Human   401 GPGPAPP-------ATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCLALPVGLALGP 458

  Fly   475 TSESSVVVEPPKKQ 488
            |.|.....|||:|:
Human   459 TREKLAPEEPPEKR 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 16/90 (18%)
ARID 299..381 CDD:279697 27/82 (33%)
Tudor-knot 692..751 CDD:288553
ARID3CXP_016869772.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.