DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid3a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001275554.1 Gene:Arid3a MGIID:1328360 Length:601 Species:Mus musculus

Alignment Length:582 Identity:123/583 (21%)
Similarity:210/583 (36%) Gaps:140/583 (24%)


  Fly   120 ESETLDQLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDDD------ESDAKEVVNEKEENIGKV 178
            :.:|..:..|:.|...|:.:.|........||.:..|:|||      |.:.:|:..|:||.    
Mouse    91 DEDTAREGTLSSPALHGSVLEGAGHAEGDRHLMDVGSDDDDTKSKWEEQELEELGEEEEEE---- 151

  Fly   179 VCVETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASK 243
               |.|...:::|:....|  .|...|::                       ..|..|||:....
Mouse   152 ---EEEDDFEEEEEEEEGL--GPPESASL-----------------------GTAGLFTRKAPPA 188

  Fly   244 QDV-----PAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDEG------------EIDSDSSDD 291
            |..     |.:.:..|.|...  |||....:    :.:...|.|            |:|:|    
Mouse   189 QAFRGDGGPRMLSGPERLGPG--PAHPSHMA----SQMPPPDHGDWTFEEQFKQLYELDAD---- 243

  Fly   292 EPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMR 356
               .::..|:..|:.:|..||||:|::|.:..:.:||:.|:..|.::||...|.::..|:.|...
Mouse   244 ---PKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKG 305

  Fly   357 LGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGC-SMLMTSRNSNRSKGR--------------- 405
            |.......|....::..|.|:|.||....|.|.. :.|..:.:|||.:||               
Mouse   306 LNLPTSITSAAFTLRTQYMKYLYPYECERRGLSSPNELQAAIDSNRREGRRQSFGGSLFAYSPSG 370

  Fly   406 ---------------SLVRANSVASPKPMETMKTETIS--KLAQPNQTNVVASTSSSAAAASVAA 453
                           .|..:.:.:|..|...:|.|..|  .:..|.:..|..:.....||.:.|.
Mouse   371 AHSMLPSPKLPVTPLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAV 435

  Fly   454 SSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQAT 518
            .:..|:|...|..:|.|:.....||:   |||:| :....|..||..::..|::.....||....
Mouse   436 QAAAAQAAVAAQAAALEQLREKLEST---EPPEK-KMALVADEQQRLMQRAVQQSFLAMTAQLPM 496

  Fly   519 SSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSAT----------IATTAMNKDAESDLP 573
            :....:.:..|...:|:..|||..|.:.::|...:|...|          .|.:|..|...|.: 
Mouse   497 NIRINSQASESRQDSAVSLTSANGSNSISMSVEMNGIVYTGVLFAQPPPPTAPSAPGKGGVSSI- 560

  Fly   574 LAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDASPSVAAPPSAGASTS 635
                                .||.::||...||....|.    .:...|.|:.|..:..|.:
Mouse   561 --------------------GTNTTTGSRTGASGSTVSG----GQVGLPGVSTPTMSSTSNN 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 16/96 (17%)
ARID 299..381 CDD:279697 24/82 (29%)
Tudor-knot 692..751 CDD:288553
Arid3aNP_001275554.1 Acidic 128..165 11/44 (25%)
BRIGHT 244..336 CDD:128777 26/92 (28%)
Important for nuclear localization 450..493 14/47 (30%)
Homodimerization. {ECO:0000250} 495..518 4/23 (17%)
Important for cytoplasmic localization 542..562 4/41 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.