DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and MSL3

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_523353.2 Gene:MSL3 HGNCID:7370 Length:521 Species:Homo sapiens

Alignment Length:463 Identity:90/464 (19%)
Similarity:150/464 (32%) Gaps:133/464 (29%)


  Fly   695 GDKLKVNYHEK-----KSPSSHGSTYEAKVIEISV-----QRGVPMYLVHYTGWNNRYDEWVPRE 749
            |.|.|.:..||     ..|:.....|:||::::.|     .|.:|.||:|:.|||..:|.|...:
Human     6 GMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED 70

  Fly   750 RIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQ---P 811
            .:..: |..:::..|.::..:                           |...:..|...|:   |
Human    71 HVLRD-TDENRRLQRKLARKA---------------------------VARLRSTGRKKKRCRLP 107

  Fly   812 GKDGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLS--------TVVKTPPTGGAKR------ 862
            |.|...|..|:...... ...|||.|...:.:....:|        |.||..|....:|      
Human   108 GVDSVLKGLPTEEKDEN-DENSLSSSSDCSENKDEEISEESDIEEKTEVKEEPELQTRREMEERT 171

  Fly   863 ---------------------GRGRSDSMPPRS---TTPSSVVAHSGRTKSPAASQPQLQQQMKK 903
                                 .|.|...:|.::   |...|.|.|.....:.:|::       :.
Human   172 ITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITILESYVKHFAINAAFSANE-------RP 229

  Fly   904 RPTRVVPGTTTPRRVSDASMASESDSDSDEPVR------------RPKRQSAKDKPQAGKAQPPG 956
            |...|:|..........|....:...:..:.:|            .|..|:...|..:.|...| 
Human   230 RHHHVMPHANMNVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQAQYKKVTSSKFFLP- 293

  Fly   957 KGRLASSASST-------APAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSL----RGSRAG 1010
               :..||:||       :|:....:.|.....|.:|:....|:.|:::.:..:|    |.:|..
Human   294 ---IKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRRSTRHS 355

  Fly  1011 GN---RAMSSGAASAKGRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEPALQDIKK 1072
            .|   .:.||.:...|.|..|.|       ...|||..:         |.||.|....:...|..
Human   356 ANCDRLSESSASPQPKRRQQDTS-------ASMPKLFLH---------LEKKTPVHSRSSSPIPL 404

  Fly  1073 EPKLESSA 1080
            .|..|.||
Human   405 TPSKEGSA 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 20/66 (30%)
MSL3NP_523353.2 Tudor-knot 14..73 CDD:314560 17/59 (29%)
MRG 157..506 CDD:310371 52/284 (18%)
Required for the histone acetyltransferase activity of the MSL complex 290..440 33/144 (23%)
Microcephalin 309..>413 CDD:315029 28/121 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.