DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and MORF4L1

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_996670.1 Gene:MORF4L1 HGNCID:16989 Length:362 Species:Homo sapiens

Alignment Length:250 Identity:49/250 (20%)
Similarity:76/250 (30%) Gaps:97/250 (39%)


  Fly   711 HGS-TYEAKVIEISVQRGVPMYLVHYTGWNNR--------------------------------- 741
            ||. .||||.::::::.....|.:||:|||.:                                 
Human    21 HGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTHEDIVALFPVPEGAPSVHH 85

  Fly   742 ------YDEWVPRERIAE----NLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSL 796
                  :|||||..|:.:    ||     ||.|.:..::....:.|...|.              
Human    86 PLLTSSWDEWVPESRVLKYVDTNL-----QKQRELQKANQEQYAEGKMRGA-------------- 131

  Fly   797 LVQGSQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAK 861
             ..|.:..|:..|............:.||..|          |..|.||.        ||    :
Human   132 -APGKKTSGLQQKNVEVKTKKNKQKTPGNGDG----------GSTSETPQ--------PP----R 173

  Fly   862 RGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQL---------QQQMKKRPTR 907
            :.|.|.|.......|..:.|  ..:.|.|...:|.|         |:|:...|.:
Human   174 KKRARVDPTVENEETFMNRV--EVKVKIPEELKPWLVDDWDLITRQKQLFYLPAK 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 18/80 (23%)
MORF4L1NP_996670.1 Tudor-knot 11..103 CDD:314560 18/82 (22%)
Interaction with KAT8. {ECO:0000269|PubMed:12397079} 26..62 10/36 (28%)
Sufficient for interaction with SIN3A. {ECO:0000269|PubMed:12391155} 133..266 24/118 (20%)
Nuclear localization signal. {ECO:0000255} 135..146 2/11 (18%)
Interaction with RB1-1 164..230 17/77 (22%)
MRG 176..351 CDD:310371 12/53 (23%)
Sufficient for interaction with PHF12. {ECO:0000269|PubMed:12391155} 188..342 9/41 (22%)
Interaction with RB1-2 323..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.