DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and ARID5A

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_016858672.1 Gene:ARID5A HGNCID:17361 Length:657 Species:Homo sapiens

Alignment Length:714 Identity:130/715 (18%)
Similarity:207/715 (29%) Gaps:300/715 (42%)


  Fly   272 GLTN-ISSDDEGEIDSDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAV 335
            |:.| ||.:|..|...:..:::..||:..|:..|||:|.:|.||:.:||.:..:.::|:::::||
Human    42 GIQNPISLEDSPEAGGEREEEQEREEEQAFLVSLYKFMKERHTPIERVPHLGFKQINLWKIYKAV 106

  Fly   336 QKRGGYN-----------------------------------------------------RVTSQ 347
            :|.|.|.                                                     :||.:
Human   107 EKLGAYELSMALGERIGWPLLEPQSSCQTAVLRVPARAAGAARTPPPGGARRPRPHEVPLQVTGR 171

  Fly   348 NQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANS 412
            ..||.:...||.:|.:.|.....::.|::.:.||                          ||...
Human   172 RLWKNVYDELGGSPGSTSAATCTRRHYERLVLPY--------------------------VRHLK 210

  Fly   413 VASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVAASS-TPARAVSTASQSAAEESGNTS 476
            ....||:.|.|.....|:|:.|:.:..|:.....|........ .|.:..:.|:..|...|    
Human   211 GEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPS---- 271

  Fly   477 ESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAA 541
                 .|||:.      ::.|||                 ..|..:|:..|||....|....   
Human   272 -----QEPPRN------STEQQG-----------------LASGSSVSFVGASGCPEAYKRL--- 305

  Fly   542 ASTATNLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASAS 606
                  |||....|:..|.:....|...:.  ::|::|........||..|.:            
Human   306 ------LSSFYCKGTHGIMSPLAKKKLLAQ--VSKVEALQCQEEGCRHGAEPQ------------ 350

  Fly   607 SKANSAEMQRSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQAS 671
                         |||:|..|.|. .|..|.        .:..:|:.:.|         |..||.
Human   351 -------------ASPAVHLPESP-QSPKGL--------TENSRHRLTPQ---------EGLQAP 384

  Fly   672 SGKRKKE----KISVEKIDTGDFVVGIGDKLK-VNYHEKKSPSSHGSTYEAKVIEISVQRGVPMY 731
            .|..::|    ......|..|.|.....:.|| |:.|                            
Human   385 GGSLREEAQAGPCPAAPIFKGCFYTHPTEVLKPVSQH---------------------------- 421

  Fly   732 LVHYTGWNNRYDEWVPRE---RIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGG 793
                           ||:   |:.:.:..|                                   
Human   422 ---------------PRDFFSRLKDGVLLG----------------------------------- 436

  Fly   794 GSLLVQGSQPPGVSDKQPGKDGCSKMSPS---SGNSTGPGAPSLSGSLGG---ASSTPSLLSTVV 852
                            .|||:|.|...|.   .|::..|.|....||..|   .......:|.:.
Human   437 ----------------PPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSPMA 485

  Fly   853 KTPPTGGAKRGRGRSDSMPPRSTTPSSV------------VAHSGRTKSPAASQPQLQQQMKKR 904
            |.|         ..|.::||  |.|||.            .||||  |...|..|.|::...|:
Human   486 KVP---------AESPTLPP--TFPSSPGLGSKRSLEEEGAAHSG--KRLRAVSPFLKEADAKK 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 26/135 (19%)
Tudor-knot 692..751 CDD:288553 7/63 (11%)
ARID5AXP_016858672.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104870466
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.