DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and ARID3B

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001294868.1 Gene:ARID3B HGNCID:14350 Length:561 Species:Homo sapiens

Alignment Length:558 Identity:124/559 (22%)
Similarity:202/559 (36%) Gaps:153/559 (27%)


  Fly   148 RGHLNEDSSEDD----DESDAKEV--VNEKE-ENIGKVVCVETESKKKDK----EKWFPALVVAP 201
            ||::|.:..|:|    ||....||  |.||| :...|...|:..:::..:    ....||..:.|
Human    84 RGNMNSEPEEEDGGLEDEDGDDEVAEVAEKETQAASKYFHVQKVARQDPRVAPMSNLLPAPGLPP 148

  Fly   202 TAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQAALEFLDSSVLPAHWD 266
            ..|.......||                           |||.. |:|..|.:        .:|:
Human   149 HGQQAKEDHTKD---------------------------ASKAS-PSVSTAGQ--------PNWN 177

  Fly   267 RDSLF----GLTNISSDDEG----EIDSDSS-----DDEPHEEKDRFVAQLYKYMDDRGTPLNKV 318
            .|...    ||. .|.|.:|    ||..|.:     |.:|  |:..|:..|:.:|..||||:|::
Human   178 LDEQLKQNGGLA-WSDDADGGRGREISRDFAKLYELDGDP--ERKEFLDDLFVFMQKRGTPINRI 239

  Fly   319 PSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGD 383
            |.:..:.:|||.|::.|.::||...:.::..|:.|...|.......|....::..|.|:|..|..
Human   240 PIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLYAYEC 304

  Fly   384 FHRKLGC-SMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSSSAA 447
            ..:.|.. :.|..:.:.||.:||....::|:....|                     |:.:::||
Human   305 EKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSP---------------------AAATAAAA 348

  Fly   448 AASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKG------------------SAA 494
            |.:.|..|.|..........:   |..|:.||..:.|....|||                  :.|
Human   349 AGAPALLSPPKIRFPILGLGS---SSGTNTSSPRISPATTLRKGDGAPVTTVPVPNRLAVPVTLA 410

  Fly   495 SSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGAS-------------------ASAAAMP---- 536
            |.|.|...:.:|:..|:      ..||..|...||                   :.|..:|    
Human   411 SQQAGTRTAALEQLRER------LESGEPAEKKASRLSEEEQRLVQQAFQRNFFSMARQLPMKIR 469

  Fly   537 ------TTSAAASTATNLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKET 595
                  ..:.|::.|.||::::.|        ::|...  |:..........|.....|.:....
Human   470 INGRAEDRAEASAAALNLTTSSIG--------SINMSV--DIDGTTYAGVLFAQKPVVHLITGSA 524

  Fly   596 NISSGSSASASSKANSAEMQRSRDASPSVAAPPSAGAS 633
            ..|.|||||:||.::.:....|...:||  |.||...|
Human   525 PQSLGSSASSSSSSHCSPSPTSSRGTPS--AEPSTSWS 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 16/96 (17%)
ARID 299..381 CDD:279697 23/82 (28%)
Tudor-knot 692..751 CDD:288553
ARID3BNP_001294868.1 Interaction with RB1. {ECO:0000269|PubMed:10446990} 203..365 43/185 (23%)
BRIGHT 216..305 CDD:128777 26/91 (29%)
Interaction with ARID3A. {ECO:0000269|PubMed:17400556} 490..513 4/33 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.