DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and LOC102555137

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_017446907.1 Gene:LOC102555137 RGDID:7566528 Length:381 Species:Rattus norvegicus

Alignment Length:298 Identity:71/299 (24%)
Similarity:125/299 (42%) Gaps:85/299 (28%)


  Fly  2222 IVGITPLPPDTPPPVPVAAIQQQQQHQLQSGQQQQAAKTGEVNPSGPNSS--------PDSASQD 2278
            :|.:..|.....|.:....::..:.:.|           |.|.|..|:.|        |.::|||
  Rat   107 LVDLDDLDERDKPSIEDVIVEGSESNSL-----------GSVLPDLPSVSQHSFSVALPLTSSQD 160

  Fly  2279 ES-GEEAKKNAGLE-----HEDSTGLGALNKRKRNRKPLPMSAQTAAAVAAQLQSLGKRRRQVSG 2337
            || |.:::.:..:|     .|...||  ..:...||....:::.|...:..:      |:|:..|
  Rat   161 ESRGIKSEGDITIEVDSIAEESQEGL--CERESANRSEASVASGTCGIITRE------RKRRAKG 217

  Fly  2338 M------------RNQKTT---TTAA----------GSDTD-----DNSDNIAP----NAGQQQQ 2368
            .            :.||.|   |:||          .||::     |:|.|..|    |..:.|:
  Rat   218 QKRPSDANSVLMTKKQKQTPKRTSAAAKSEKNGAGQSSDSEDLPATDSSSNSTPVKHLNLPKPQK 282

  Fly  2369 QPRQSARQHMMPQSNAQQQQQQQLLQQQQTQLPQGIQSTNSSGVRPCPYNF-LVELDPALSSDEC 2432
            .||..||..::.....::.:::..                .|..|...::| |.||| .::|.|.
  Rat   283 LPRSPARVSLLKDRGKEKHKEKPA----------------DSSPRTYKWSFQLNELD-NMNSIER 330

  Fly  2433 ITILRKQIQDLRKAYNTIKGELAVIDRRRKKLRRRERE 2470
            ::.|:::.|::||.|.::|.|:|.||||||.|:|::||
  Rat   331 LSFLQEKAQEIRKHYMSLKLEVATIDRRRKSLKRKDRE 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553
LOC102555137XP_017446907.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.