DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and LOC100912163

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_008770058.1 Gene:LOC100912163 RGDID:6488837 Length:1355 Species:Rattus norvegicus

Alignment Length:1569 Identity:416/1570 (26%)
Similarity:638/1570 (41%) Gaps:406/1570 (26%)


  Fly     4 MDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRVGAV 68
            :|:||.|.|||:|||||:|||||||:....|.:||||.::....:..|.||.||.|   |:|||:
  Rat    45 LDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGP---LKVGAI 106

  Fly    69 VEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLTHPE 133
            |||::.| ....||.|.|:.|.|.|||||||||..||||::||||..|||.|||||||||||:||
  Rat   107 VEVKNLD-GAYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETLDQLPLTNPE 170

  Fly   134 HFGNPVVGGR--RGRRRGHLNED----SSEDDDESDAKEVVNEKEENIGKVVCVETESKKKDKEK 192
            |||.||:|.:  ||||..|:.|:    ||.||||.|.|:.    :|.:||||||:..|..|.|..
  Rat   171 HFGTPVIGKKTNRGRRSNHIPEEESSSSSSDDDEDDRKQT----DELLGKVVCVDYISLDKKKAL 231

  Fly   193 WFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQA---ALE 254
            |||||||.|.....:.:: ||..||||||||::.:||:|:..|.|.:.|.|.|....||   |||
  Rat   232 WFPALVVCPDCSDEIAVK-KDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFDQALE 295

  Fly   255 FLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPH----------------EEKDRFVAQ 303
            |..|..:||:|..:    |...||..|.|.:.:..|||..                ||::.|:.|
  Rat   296 FHKSRTIPANWKTE----LKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQ 356

  Fly   304 LYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMN 368
            |||:|:|||||:||.|.:..|:::|::|||.|.|.||::.:.|...||.:...||     :.|:|
  Rat   357 LYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLG-----IPVLN 416

  Fly   369 L-----VKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASP-----KPMETMK 423
            .     ||.||||:|..:.::.|.......|                   |.|     ||.:..:
  Rat   417 SAAGYNVKCAYKKYLYGFEEYCRSANIDFQM-------------------ALPEKVLNKPCKDCE 462

  Fly   424 TETI----SKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEP 484
            .:.|    ...|:..:.||..|.:      .:....|||.              :.||....::|
  Rat   463 NKEIKVKEESDAEIKEVNVEDSKN------MIPKEETPAE--------------DESERKENIKP 507

  Fly   485 PKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLS 549
            ....:||            |:|                           .:|..|          
  Rat   508 SLGSKKG------------LLE---------------------------CIPAQS---------- 523

  Fly   550 SATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEM 614
                             |.|.:..:.|::        .:.|:|.:...::.:..:.|::.::.|.
  Rat   524 -----------------DQEKEANITKLE--------EKESLEDKDGATARAEEALSTEVDAEEE 563

  Fly   615 Q-RSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKE 678
            | ||.|                         ...||:.:..::.::|:::|:||.:........|
  Rat   564 QARSGD-------------------------ETNKEEDEDDEEIEEEEEEDEEEDEDEDDDDNNE 603

  Fly   679 KISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYD 743
            :...|....       |.|::|.|...|:.    ..|||.:.:..|:.|..:|||||.|||.|||
  Rat   604 EEEFECYPP-------GMKVQVRYGRGKNQ----KMYEASIKDSDVEGGEVLYLVHYCGWNVRYD 657

  Fly   744 EWVPRERIAENLTKG--------------SKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGG 794
            ||:..::|.....|.              .|:|.|....|..|                      
  Rat   658 EWIKADKIVRPADKNVPKIKHRKKIKNKLDKEKDRDEKYSPKN---------------------- 700

  Fly   795 SLLVQGSQPPGVSDKQPGKDGCSKMSPSSGNSTGPG---APSLSGSLGGASSTPSLLSTVVKTPP 856
            ..|.:.|:.|..|:  |..:..||:..:...::..|   :..::..|.|..::.|         .
  Rat   701 CKLRRLSKSPFQSN--PSPEMVSKLDLADAKNSDTGHIKSIEITSILNGLQASES---------S 754

  Fly   857 TGGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQ-----PQLQQQMKKRPTRVVPGTT--T 914
            ...:::...|....|..|:...|.|.||..::|...|:     |.|.::.|..|..|:..|.  :
  Rat   755 AEDSEQEEERCAQDPESSSKDESKVEHSAHSRSELISKEELSSPSLLEENKVHPDLVIAKTVSKS 819

  Fly   915 PRRV-SDASMASE-SDSDSDEPVRRPKRQSAKD------KPQA--GK---------AQPPGKGRL 960
            |.|: .|....|| :|.:.::.:.:.::...||      |||.  ||         .|....|:.
  Rat   820 PERLRKDVEAISEDTDFEEEDEITKKRKDVKKDTTDKALKPQTKRGKRRYCNTDECLQSGSPGKK 884

  Fly   961 ASSASSTAP-AAHPSDDSEEDEEEEEPSAARAASSKQQ---QQQASSLRG-------SRAGGNRA 1014
            .....|..| ....|.:|..||:|||.|.|:...:|:.   :::..|||.       |.....|.
  Rat   885 EDRTKSKEPLCTGNSSNSSSDEDEEEKSKAKMTPTKKYNGLEEKRKSLRTTSFYSGFSEVAEKRI 949

  Fly  1015 M---SSGAASAKGRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEP-------ALQD 1069
            .   :|.......|..|..::.|.::|..||.......::...:.|...|...|       :||.
  Rat   950 KLLNNSDERLQNNRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHAAPDEGTVEESLQT 1014

  Fly  1070 IKKEPKLESSAKSSSTE----LSSETESYADEDSQSSDYRKQLKGSGAG---KKEPTA--SPSKL 1125
            :.:|   ||.:.:...|    .|.:::...::..:.||.:.:...||:.   ...||.  |||. 
  Rat  1015 VAEE---ESCSPNMELEKPLPTSVDSKPVEEKPLEVSDRKTEFPSSGSNSVLNTPPTTPESPSS- 1075

  Fly  1126 HHEPVTKRELAVKEEPLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPAR----FGNTSAA--- 1183
                ||..|.:.::..:.:.....|.:||.:|....:.:.|:..:::...:    .||:|.|   
  Rat  1076 ----VTVTETSQQQSSVTVSVPLPPNQEEVRSIKSETDSTIEVDSVVGELQDLQSEGNSSPAGFN 1136

  Fly  1184 QAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQESK 1248
            .:.|||.|:....::.    ||..|  |:|.|            |.:.|.|    |||...:.|.
  Rat  1137 ASVSSSSSNQPEPEHP----EKACT--GQKRV------------KDTQGVG----SSSKKQKRSH 1179

  Fly  1249 KFAEPVASLKVEMPAACSPSSSSSSSSSFCSTGSAVSSSSATRSLPDMSKLEISSGTVPGATPGA 1313
            | |..|.:.|       ....::||.|...|.|.:|:.:.|.:|:|...|...|.......:||.
  Rat  1180 K-ATVVNNKK-------KGKGTNSSDSEDLSAGESVTKTQAIKSVPTGMKTHNSKSPARIQSPGK 1236

  Fly  1314 AA---------LQPSNVAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEFKDTEPFEFE 1369
            ..         .:|||       ...|..|:|                     ::..|.|.....
  Rat  1237 CGKNGDKDPDLKEPSN-------RLPKVYKWS---------------------FQMSDLENMTSA 1273

  Fly  1370 KRISPM-----------ASVGGTVAAAATAAGAMAAAGAASVITTMVPTPGASGSGVAASASTSA 1423
            :|||.:           .|:...||:.......:......|..|:...:..:|.|..||...|.|
  Rat  1274 ERISILQEKLQEIRKHYLSLKSEVASIDRRRKRLKKKERESAATSSSSSSPSSSSITAAVMLTLA 1338

  Fly  1424 PVVVGSAAR 1432
            ...:.||::
  Rat  1339 EPSMSSASQ 1347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 43/94 (46%)
ARID 299..381 CDD:279697 37/87 (43%)
Tudor-knot 692..751 CDD:288553 23/59 (39%)
LOC100912163XP_008770058.1 TUDOR 99..154 CDD:197660 33/59 (56%)
RBB1NT 210..303 CDD:285392 43/98 (44%)
ARID 352..435 CDD:198082 37/88 (42%)
Tudor-knot 612..665 CDD:288553 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104862000
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.