DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid4b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_005173089.1 Gene:arid4b ZFINID:ZDB-GENE-160607-1 Length:1240 Species:Danio rerio

Alignment Length:1559 Identity:402/1560 (26%)
Similarity:585/1560 (38%) Gaps:494/1560 (32%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:.:::||.|.|||:|||||:|||||||:....|.:|.||.::....:..|.|:.|:   |.|:|
Zfish     1 MKTLEEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKAKVTFRPDASTAEVHDEHIR---GLLKV 62

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            |||||.|:.| ....||||.|:.|.|.|||||||||..||||::||||..|||.||||||:||||
Zfish    63 GAVVEARNQD-GVYQEATINKLTDASLYTVVFDDGDEKTLRRSSLCLKGARHFAESETLDRLPLT 126

  Fly   131 HPEHFGNPVVG--GRRGRRRGH-LNED----SSEDDDESDAKEVVNEKEENIGKVVCVE---TES 185
            :|||||.||:|  |.||.||.: :.|:    ||.:::|.|.:    :.||..|||||||   |..
Zfish   127 NPEHFGTPVIGKKGNRGGRRSNPIQEEESSSSSSEEEEGDQQ----QNEELYGKVVCVEGVLTND 187

  Fly   186 KKKDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDV---P 247
            ||  |..|:||||::|.....|.:: ||...|||||||::|||.:|:..|...:.|.|.|.   |
Zfish   188 KK--KSTWYPALVISPDCHEDVTLK-KDNVFVRSFKDGKFYTVLRKDIRELDEDKAPKADAGLKP 249

  Fly   248 AVQAALEFLDSSVLPAHW-----DRDSLFGLTNISSDDEGEIDSDSSDDEPH------------E 295
            |:.||.||..:..:|..|     |..|       ||:||.|.:.:..::|..            |
Zfish   250 ALDAAWEFQRNGAVPNTWRTEVKDESS-------SSEDEEEEEEEEQEEEASSEEEEEEVEPFPE 307

  Fly   296 EKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFT 360
            |||.|:.||||:|:|||||:||.|.:..::::|::|:|.|.|.||::.:.|.:.||.:...||  
Zfish   308 EKDNFLQQLYKFMEDRGTPINKRPVLGYKNLNLFKLYRLVHKLGGFDNIESGSVWKQVYQDLG-- 370

  Fly   361 PCTVSVMNL-----VKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPME 420
               :.|:|.     ||.||:|:|..:.|:....|.|.                            
Zfish   371 ---IPVLNSAAGYNVKCAYRKYLYGFEDYCTSTGISF---------------------------- 404

  Fly   421 TMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPP 485
                    ::..|.:|...||..:...|..|.:                  :|||    |.:..|
Zfish   405 --------RMDLPYKTGEKASCKTEVKAEEVIS------------------AGNT----VSLNTP 439

  Fly   486 KKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSS 550
            ::.             ||:.|  .|:|                                      
Zfish   440 EEH-------------KSITE--SERS-------------------------------------- 451

  Fly   551 ATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQ 615
                                               .|||.:::|                     
Zfish   452 -----------------------------------CTRHLLKEE--------------------- 460

  Fly   616 RSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQA-SSGKRK--- 676
                 ......|....|..||        .||:::    |.|::|.:.::|.||. |:|:..   
Zfish   461 -----KTETVTPCEEKADISG--------ENKEDE----KHAEEENEMNEEVKQCMSTGETDVTE 508

  Fly   677 --KEKISVEKID---TGDF------------VVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISV 724
              ||:...|..|   :||.            ....|.|::|.|...:|.    .||:|.|.|.::
Zfish   509 DVKEEPCEEPDDKDLSGDVSSQEWEEGQEFECYPPGMKVQVRYGRGRSL----KTYDATVKESNL 569

  Fly   725 QRGVPMYLVHYTGWNNRYDEWVPRERIAENLTKG------------------------------S 759
            :.|..:|||||.|||.|||||:..::|.....|.                              .
Zfish   570 EGGEVLYLVHYCGWNVRYDEWIKADKIVRPANKNVPKIKHRKKIKNKAERERDRIERLADREDLP 634

  Fly   760 KQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGKDGCSKMSP--S 822
            ..|.|....|..|||.                                      |..|||..  .
Zfish   635 SSKNRINRLSKVNSGG--------------------------------------DVFSKMEECVD 661

  Fly   823 SGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAKR---------------GRGRSDSMPP 872
            .||.......|:...|.|:.|:            |..::|               |..::|  ||
Zfish   662 KGNQQSIEITSILNGLPGSDSS------------TDDSEREEDEDADHDEDDDHPGAHKAD--PP 712

  Fly   873 RSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRR 937
            :|       .|..:..||..: |:.....::.|| :...|..|:|       .|.|:|:... ||
Zfish   713 QS-------QHWEKNSSPPEA-PKTPADAEQEPT-LQDSTEAPKR-------KELDTDASAG-RR 760

  Fly   938 PKRQSAKDKPQAGKAQPPGKGR------------LASSASSTAPAAHPSDDSEEDEE---EEEPS 987
            .|.::....|..||.:....|.            ...|:|...|..||.:.|...::   .:|.|
Zfish   761 KKAENTSKSPAKGKTRNSRGGEWLQSGSPKKLEDRGESSSEDEPKGHPKNKSSPSKKYNGVKEKS 825

  Fly   988 AARAASSKQQQQQASSLRG--SRAGGNRAMSSGAASAKGRDYDLSEIRSELKGFQPKLLTNAASN 1050
            .:|.|..:..:::|....|  .|:.|.|        .||:    .::.|.::...||.......:
Zfish   826 KSRGAFWEIPEKRAKVSAGIEERSPGCR--------TKGQ----KDVWSSIQVQWPKKTLKELFS 878

  Fly  1051 EERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTELSSETESYADEDSQSSDYRKQLKGSGAGK 1115
            :...:.|...|...|           |:.::|:..|...|.|....::..||.....|.......
Zfish   879 DSDTEAANSPPPAGP-----------EACSESARDEEEEEEEEEKLQEHPSSGTNSVLNTPPTTP 932

  Fly  1116 KEPTAS--PSKLHHE---PVTKRELA-------VKEEPLKIEPKTEPKEEETKSKPFLS-GADIK 1167
            :.|.|:  |:::..|   |.....||       :.||||..||.....|.::.:....| |.:|:
Zfish   933 ESPAAAEGPAEILPEVRAPSPPAALAASPPPVSLPEEPLMEEPAGGRSESDSSTVEVESLGGEIQ 997

  Fly  1168 ----PTALIAPARF----------GNTSAAQAASSSGSSSTTAKYTSVIVEKPLTIGG---KKSV 1215
                .....:|::.          .|.|...:.||...|...||.:|.......:.||   ||..
Zfish   998 EMNAEEGAGSPSKAFDGNMSCNSNSNCSLTLSNSSQQESEQKAKASSSQKRHKESQGGGATKKHK 1062

  Fly  1216 EQHVPKKAELLKKQSGGAGGTAASSSAASQESKKFAEPV----ASLKVEMPAACSPSSSSSSSSS 1276
            ..|  |...|..|:|..|..::.|......||...:.||    |.||..:...||..:..|....
Zfish  1063 RSH--KNLSLQPKKSRKAAHSSDSEDQCISESTAKSPPVKSSGAELKSSITHKCSSRTPPSGQQR 1125

  Fly  1277 FCSTGSAVSSSSATRSLPDMSKLEISSGTVPGATPGAAALQ-------------PSNVAQVSSSG 1328
            :........|...||....||.||..|     :....:.||             .|.||.:....
Zfish  1126 YHKHTDTEHSHGRTRWSFQMSDLEKMS-----SLERISFLQEKLQDIRNHYLLLKSEVASIDRRR 1185

  Fly  1329 AAKESKYSSSGGAAAGSGISMRKLLSSDVYEFKDT--EPFEFEKRISPMASVGGTVAAAATAAG 1390
            ...:.|...:|.|||.|..|.....||.......|  ||               ||:||:..||
Zfish  1186 KRIKKKERETGAAAASSSSSSSPSSSSLTAAVMLTLAEP---------------TVSAASQTAG 1234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 43/97 (44%)
ARID 299..381 CDD:279697 34/87 (39%)
Tudor-knot 692..751 CDD:288553 24/59 (41%)
arid4bXP_005173089.1 TUDOR 60..109 CDD:197660 32/50 (64%)
RBB1NT 170..264 CDD:285392 43/97 (44%)
ARID 309..394 CDD:198082 36/90 (40%)
Tudor-knot 543..596 CDD:288553 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 363 1.000 Inparanoid score I2102
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.