DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid5b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_017214107.1 Gene:arid5b ZFINID:ZDB-GENE-121214-272 Length:1079 Species:Danio rerio

Alignment Length:805 Identity:151/806 (19%)
Similarity:286/806 (35%) Gaps:166/806 (21%)


  Fly   268 DSLFGLTNISSDDEGEIDSDSSDDEP--------HEEKDRFVAQLYKYMDDRGTPLNKVPSILSR 324
            ||..|::...:...|......|:::|        ..::..|:..|||||.:|.||:.::|.:..:
Zfish   213 DSKSGVSKPRNPSTGSCKRVQSENKPKGDGGDECRTDEQAFLVALYKYMKERKTPIERIPYLGFK 277

  Fly   325 DVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLG 389
            .::|:.:|:|.||.|||..:|::.|||.:...||..|.:.|.....::.|::.:.||..|.:...
Zfish   278 QINLWTMFQAAQKLGGYEVITARRQWKNVYDELGGNPGSTSAATCTRRHYERLILPYERFTKGEE 342

  Fly   390 CSMLMTS--RNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVA 452
            ...|..:  |....|...|:::|..:...:|.:..||....|.|.                    
Zfish   343 DKPLPPAKPRKQEGSVQESIIKAKMMPIKRPKDEQKTPRGDKDAS-------------------- 387

  Fly   453 ASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEK---STA 514
                 |:.:....:. .||......|..:..|.:..|..::..::..: ..||.|.|::   ..|
Zfish   388 -----AKVLELGMED-MEELQEKQNSQQLQAPTQTDRDPNSPLTEDDE-GVLVIKDEDQPVLHNA 445

  Fly   515 VQATSSG---TVAGSGASASA--------AAMP-------------------------TTSAAAS 543
            .:..:.|   ::...||...:        ||:|                         ..||.|:
Zfish   446 YEHANGGLLPSLPQDGAQLKSEDCDAFPVAAVPLHHGHPLPNSHTSDQWKHGILEYKVPPSALAN 510

  Fly   544 TATNLSSATSGGSATIATTAMNKDAES-DLPLAKIKAAAVAAASTRHSMEKETNISS-------- 599
            ...:...........:..|...|...| ::|..:::           .::||.:..:        
Zfish   511 VEQSRPKEGQNQVVMVLPTLQQKPVTSPEIPPERVE-----------PLKKEESCFNFNPLLYPR 564

  Fly   600 GSSASASSKANSAEMQR-------------------SRDASPSVAAPPSAGASTSGAAATAQTAS 645
            |:....|..|....:.:                   ||..|.|.....|||.|:|..:::.:|:.
Zfish   565 GNPGIMSPLAKKKMLSQVSGTGLLNNYPYGPPPPLVSRRLSSSGTEVSSAGQSSSQVSSSVETSI 629

  Fly   646 NKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSS 710
            ..| :....:.|...|.:..|::::|:...:|:..|     .|:.|......::..|.::..|  
Zfish   630 VIK-RPSVIQHAQSFKSRGSEDRRSSTEGSQKDGCS-----EGEPVHHSQTLIREPYLKRVDP-- 686

  Fly   711 HGSTYEAKVIEISVQRGVPMYL------VHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTS 769
            |.|.  .|..|:......|.:|      .|......:.:..:.:|:|       ||..:|.:.|.
Zfish   687 HSSM--EKSAEMPRPGQAPSFLSEFYSSPHLHNLCRQTEHHLSKEQI-------SKYLSRDVYTR 742

  Fly   770 SANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSL 834
            .:.:..|..........|.......|...:|..|..|:::||......|.||..       .|..
Zfish   743 DSETAQGFPPSQHPDNVGLNFSARLSQKEKGPPPERVTEEQPTDLSLPKSSPLK-------LPLS 800

  Fly   835 SGSLGGASSTPSLLSTVVKTPPTGGAKRGRGRSDS---------MPPRSTTPSSVV--AHSGRTK 888
            :.:|||...  :.:...:|..|...|  |..:|.|         :||.:.:.|..|  :||...:
Zfish   801 TSTLGGIPH--AAIQQDIKNSPHFQA--GNSQSSSVDYHPRACRVPPMTVSASKKVTESHSKVLE 861

  Fly   889 SPAASQPQLQQQMK----KRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQA 949
            ....|:.:.....|    .||  ::...::|:.:..|.....:..|.:......|.::......:
Zfish   862 KTPNSRGEESMGFKIDEMSRP--ILSTKSSPQNICTARPLKRNIEDLENGPTEKKIRAVTPLHCS 924

  Fly   950 GKAQPPGKGRLASSASSTAPAAHPS 974
            .:...|||.|...:.|.:...|.|:
Zfish   925 TQRDLPGKPRTPEADSESVKPAEPA 949

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 28/82 (34%)
Tudor-knot 692..751 CDD:288553 10/65 (15%)
arid5bXP_017214107.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.