DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid3b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_004916060.1 Gene:arid3b XenbaseID:XB-GENE-1018456 Length:548 Species:Xenopus tropicalis

Alignment Length:609 Identity:129/610 (21%)
Similarity:226/610 (37%) Gaps:140/610 (23%)


  Fly    73 HPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTAL----------CLKS--GRHFNESETLD 125
            ||.:...:||.:.::|...|......:.....:|.|..          .:||  |...|.|.. .
 Frog    31 HPKQGMKLEAVMEQLQKQQQQAARSMEERERQIRETQRLYAQQLASQHAMKSIPGPSPNSSGR-T 94

  Fly   126 QLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDDDESDAKEVVNEKEENIGKVVCVETESKKKDK 190
            :||:..|....:|             .:|...|.|.||..:...|:|::               :
 Frog    95 RLPVGPPHSASDP-------------EDDDEMDGDGSDDGDSYEEREDS---------------R 131

  Fly   191 EKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQ---AA 252
            |           |..|.   :..:|| ::.::.:..:||.::.|:..|.:..|:: ||.:   |:
 Frog   132 E-----------AHGTT---LAQKYL-QAQRELQGISVPNRQGTQNHRPLTVKEE-PAEENFNAS 180

  Fly   253 LEFLDSSVLPAH-------WDRDSLFGLTNISSDDEG---EIDSDSSDDEPHEEKDRFVAQLYKY 307
            ...|....:..|       |..|. .|.:..:|.|..   |:|||       .::..|:..|:.:
 Frog   181 PGNLHKQNMEEHIKQENSSWCEDP-DGRSRETSRDFAKLYELDSD-------PKRKEFLDDLFMF 237

  Fly   308 MDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQ 372
            |..:|||::::|.:..:.:|||.|::.|.::||...|.::..|:.|...|.......|....::.
 Frog   238 MQKKGTPISRIPIMAKQLLDLYMLYKLVTEKGGLVEVINKKIWREITKGLNLPTSITSAAFTLRT 302

  Fly   373 AYKKFLQPYGDFHRKLGC-SMLMTSRNSNRSKGRSLVRANSV--ASPKPMET---MKTETISKLA 431
            .|.|:|..|....:.|.. :.|..:.:.||.:||.....:|.  .||.|..|   :....:....
 Frog   303 QYMKYLYLYECEKKSLSSPAELQAAIDGNRREGRRPSYGSSTFSYSPTPQGTSGLLGANKVPVAM 367

  Fly   432 QPNQTNVVASTSSSAA-------------AASVAASSTPARAVSTASQSAAEESGNTSESSVVVE 483
            ....|.:...|:....             :..|....||. .|.|||   .|:..:..|..   |
 Frog   368 MGGHTRISPVTTLKKGDNAVGLMGGRMPLSLPVGTQQTPT-GVRTAS---LEQLKDRLEMG---E 425

  Fly   484 PPKKQRKGSAASSQQGKVKSLVEKYEEK--STAVQATSSGTVAGSGASASAAAMPTTSAAASTAT 546
            ||:|:...::...||   :.:.:.:::.  |.|.|......:.|..|.....|   |....:::.
 Frog   426 PPEKRASRTSVEEQQ---RIIQQAFQQNLLSMARQIPMKLKINGKVAQDRQEA---TLNLGTSSI 484

  Fly   547 NLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANS 611
            |:|...:|   |:.|..:.  |:..:||        .|..|..|      :.||||::.|..:.|
 Frog   485 NMSIEING---TMYTGILY--AQKPVPL--------IAGYTGQS------VGSGSSSNTSQASQS 530

  Fly   612 AEMQRSRDASPSVAAPPSAGASTS 635
            ....|         ..|.|..|||
 Frog   531 PTSSR---------GTPGAEPSTS 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 15/94 (16%)
ARID 299..381 CDD:279697 22/82 (27%)
Tudor-knot 692..751 CDD:288553
arid3bXP_004916060.1 BRIGHT 225..314 CDD:128777 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.