DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and msl3

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_004912403.1 Gene:msl3 ID: Length:383 Species:Xenopus tropicalis

Alignment Length:232 Identity:51/233 (22%)
Similarity:81/233 (35%) Gaps:75/233 (32%)


  Fly  1777 PTAKLDLCSSAIKLDTLKLLSEPLKIQTGPLLGELYRPGPATSSPETKSILESS--LPAKNSELS 1839
            |...::||...:  |.|::..:    .|.||:  |..|...|   :.|.::.|.  ||.:.|   
 Frog    80 PEKNVELCKEMV--DGLRITFD----FTLPLI--LLYPYEQT---QYKKVMSSKFFLPIRES--- 130

  Fly  1840 ETIQKLECAIQQRKTPVGGALSLASSTAGTPPTAHTPNSTATAGAGFSDESMDSTDSEQRLVIED 1904
                   .:|..|.         ....:.:||..:.|             :..||||:.      
 Frog   131 -------ASIGNRN---------QEEVSPSPPLLNPP-------------TPQSTDSQH------ 160

  Fly  1905 VIAEEHTTTTTTGEQKSPGSQQEEG---QTNTATMATAVTAETEGTSSSTPTP-------PVPAP 1959
                      ||||..:|..::.|.   |:...:...:.:.:....||::|.|       |...|
 Frog   161 ----------TTGEPATPKRRRTEPDILQSLRRSTRHSTSCDRMSESSASPQPKRRHPETPTSMP 215

  Fly  1960 ---VKLELGAKAMPGIQAPIPLKPA-EGSSFAGKLTG 1992
               :.||.......|..:||.|.|: ||||....|.|
 Frog   216 KLFLHLEKKTPVHSGSSSPITLTPSKEGSSVFSGLEG 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553
msl3XP_004912403.1 MRG 1..335 CDD:283390 51/233 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.