DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid5b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_002939588.1 Gene:arid5b XenbaseID:XB-GENE-1007579 Length:1183 Species:Xenopus tropicalis

Alignment Length:1138 Identity:213/1139 (19%)
Similarity:359/1139 (32%) Gaps:371/1139 (33%)


  Fly   287 DSSDD-----EPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTS 346
            |..||     |...|:..|:..|||||.:|.||:.::|.:..:.::|:.:|:|.||.|||..:|:
 Frog   312 DGEDDGYKVEEGKAEEQSFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITA 376

  Fly   347 QNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRAN 411
            :.|||.|...||..|.:.|.....::.|::.:.||..|            .|....|...|.:  
 Frog   377 RRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERF------------INGEEDKPLPLTK-- 427

  Fly   412 SVASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTS 476
                |:..|....|...|:.       :..|                :.:....|...:|.....
 Frog   428 ----PRKPENGPQEVDMKVK-------ICGT----------------KRIKNEPQKPKKEKDAKG 465

  Fly   477 ESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTS-- 539
            .....|.|.::..       .:...|::...|:.:.|......|.:|      .|....|:.|  
 Frog   466 YDMAEVPPDEEDH-------LEADEKNMPFGYDSEETKTSVDKSESV------VSEVKYPSLSEN 517

  Fly   540 -AAASTATNLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKET-------N 596
             ....|..|....|....:.       :||:....|..:|.........|..|..||       .
 Frog   518 DELEETIANQDHVTQDEDSC-------QDADPVDSLICVKEIDSRQTDERLQMPNETMTITKQEQ 575

  Fly   597 ISSGSSASASSKANSAEMQRSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEK 661
            |....|......|...::.    ..|:|..|                      :|          
 Frog   576 IKPDYSDHLEDDAEDVQLH----VFPAVQPP----------------------RH---------- 604

  Fly   662 DKDKEEKQASSGKRKKEKISVEKI-DTGDFVVGIGDKL-KVNYHEKKSPSSHGSTYEAKVIEISV 724
              |.||               ||: |..|::.....|: .:...:.|:|      .::.:.:.::
 Frog   605 --DMEE---------------EKLPDMPDYIANCTVKMDPLGSSDLKNP------LDSNLFQNAL 646

  Fly   725 QRGVPMYLVHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGG 789
            ::...:|||                              :|:                       
 Frog   647 KQNPKVYLV------------------------------QTL----------------------- 658

  Fly   790 GGGGGSLLVQGSQPPGVSDKQPGKDGCSKMSP---SSGNSTGPGAPS------LSGSLGGASSTP 845
                 .:|.:...||.::|     |.....:|   |.||   ||..|      |...:.|||...
 Frog   659 -----DMLNEKEAPPSMND-----DSSFSYTPLLYSRGN---PGIMSPLAKKKLLSQVSGASQPG 710

  Fly   846 SLLSTVVKTPPTGGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQM----KKRPT 906
            :|  .....||....|:...:.:..|....|     .||..::|.|.::|.:.|.:    :|.|.
 Frog   711 NL--PYGSPPPLINKKKLSSKGEVSPSLLQT-----HHSSNSESVAINRPSVIQHVQSFKQKSPE 768

  Fly   907 RVVPGTTTPRRVSD---ASMASESDSDSDEPVRRPKRQSAKDKPQAGKAQPPGKGRLASSASSTA 968
            .       .:.|:|   .||..:.||...:..:.  :||.                ||.|.:..|
 Frog   769 E-------KKTVNDHYKNSMFGKVDSYCCDFAKH--QQSV----------------LADSYALKA 808

  Fly   969 PAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGS-------RAGGNRAMSSGAASAKGRD 1026
            ..         .|.:|:.:..||||:.......:....|       |...:...:..:|....|:
 Frog   809 SI---------QECKEKMAEKRAASNSNVPSFLAEFYSSPHLHRLYRQTEHHLHNENSAKFHSRE 864

  Fly  1027 Y--DLSEIRSELKGFQPKLLTNAASNEERK----DLAKKEPSDEPALQDIKKEPKLESSAKSSST 1085
            .  ||..:.|     ..||..:|:.::..|    |:...:|:|   |...|...||.:....||.
 Frog   865 MFRDLENVSS-----SHKLHYHASLHQHDKQNLCDIVDDQPTD---LSLPKSLHKLATRIPGSSI 921

  Fly  1086 ELSSETESYADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVT----KRELAVKEEPLK-IE 1145
            ...|..:   |..|.:..:....|..|.     ..:|......|:|    ||.:.....|.| ::
 Frog   922 AHHSVQQ---DAKSHNPFHTPNSKTLGV-----DCTPKACRVSPMTMSMPKRNMDSIHRPSKTLK 978

  Fly  1146 PKTEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTIG 1210
            |.|..|.|                .|:.|...|.||     :.:.....:.|.....::.|:|  
 Frog   979 PDTVRKVE----------------GLVHPFSIGKTS-----TQNFGPPRSLKRNLEDLDHPVT-- 1020

  Fly  1211 GKKSVEQHVPKKAELLKKQSG-----GAGGTAASS-----SAASQESKKF--AEPV--------- 1254
             :|.:....|  ..|.|:.||     |..|.::.|     |.:..||.|:  :.||         
 Frog  1021 -EKKIRAVSP--LSLPKEMSGKETFVGQDGESSKSVHDIHSGSMMESHKYPLSSPVFPGMYPGSL 1082

  Fly  1255 -ASLKVEMPAA-------------CSPSSSSSSSSSFCSTGSAVSSSSATRSLPDMSKLEISSGT 1305
             ..|...:|.|             .||.....:..:|......:::|:.::.|    ..:|:||.
 Frog  1083 CGGLSSRIPTAYSHPLQYLKNQTVLSPLMQPLALHTFMMQRQYLTNSTNSQQL----YRQIASGA 1143

  Fly  1306 VPGATPG---------AAALQPSN---VAQVSS 1326
            ..|::.|         ..|:.|.:   .:|:||
 Frog  1144 PVGSSYGDLLHNSIYPLTAINPQSPFPSSQMSS 1176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 29/82 (35%)
Tudor-knot 692..751 CDD:288553 6/60 (10%)
arid5bXP_002939588.1 BAH 35..>109 CDD:295389
BRIGHT 325..417 CDD:128777 33/104 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.