DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid5a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001314703.1 Gene:arid5a ZFINID:ZDB-GENE-100525-3 Length:587 Species:Danio rerio

Alignment Length:447 Identity:98/448 (22%)
Similarity:177/448 (40%) Gaps:79/448 (18%)


  Fly   245 DVPAVQAALEFLD------SSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRFVAQ 303
            :|.|.:..||..:      :|....:.:.:||.. ||.|.|       :|..|:...|:..|:..
Zfish     8 EVDAAEGELEDCEKKNQELNSPNQTNGEMESLTS-TNSSED-------NSRSDQSESEERTFITN 64

  Fly   304 LYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMN 368
            ||.:|.:|.||:.::|.:..:.::|:::::||:..|||:.||::.|||.:...||.:|.:.|...
Zfish    65 LYCFMKERNTPIERIPHLGFKQINLWKIYKAVETLGGYDAVTARRQWKNVYDELGGSPGSTSAAT 129

  Fly   369 LVKQAYKKFLQPYGDFHRKL---GCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETISKL 430
            ..::.|::.:.|   |.|:|   ....|..|:...:.|.....|.:...|.|..:..:.|:..|:
Zfish   130 CTRRHYERLVLP---FERQLRGEEDKPLPPSKPRKQYKRSPENRGSKPESKKKRKMERDESEEKM 191

  Fly   431 AQPNQTNVVASTS------SSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQR 489
            ...:..:....:.      ||....|...|:.|...:|:......:    ||....|:.|.:|::
Zfish   192 LSDHHCDRGRCSHHSPWLISSDRLDSEHTSTAPVLGMSSRENPLLQ----TSSPPEVISPLEKKK 252

  Fly   490 KGSAAS-----SQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLS 549
            :.:.||     |:.|      .:.|..|....:.||.:......|:..:.:|.:|.:.|.:.:.|
Zfish   253 RLAQASLTIPASEDG------GELERPSVIHISHSSQSNTRGRHSSDGSPVPVSSPSGSLSRSPS 311

  Fly   550 SATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEM 614
            ..:......||.|.....|:                      |.|...::...|.::|||     
Zfish   312 PYSVSSEDCIAVTTQKSPAK----------------------EPENKTATRLPALSTSKA----- 349

  Fly   615 QRSRDASPSVAAPPSAGASTSGAAATAQ------TASNKKEKHQRSKQADKEKDKDK 665
                 .|..|..|.|...:|...|...:      ..:...||.|||..|....||.:
Zfish   350 -----VSTGVCKPLSCYPNTKELANYPRLHYREFLQAGATEKTQRSLLAWTSDDKSR 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 5/23 (22%)
ARID 299..381 CDD:279697 25/82 (30%)
Tudor-knot 692..751 CDD:288553
arid5aNP_001314703.1 BRIGHT 57..148 CDD:128777 29/94 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.