DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7058 and bath-42

DIOPT Version :8

Sequence 1:NP_573327.2 Gene:CG7058 / 32873 FlyBaseID:FBgn0030961 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_498784.1 Gene:bath-42 / 176152 WormBaseID:WBGene00016803 Length:410 Species:Caenorhabditis elegans

Alignment Length:438 Identity:95/439 (22%)
Similarity:169/439 (38%) Gaps:85/439 (19%)


  Fly   670 SKSSTINQNLEQLIMDIPAY---IFIVENLSDR---LDDKLGWK--EFKFCFKLATSQINGVIAK 726
            |.:..||:.:.....|:|..   :.:|...:.|   |..||.||  :|:...||..:..| :|::
 Worm     8 SSTEQINRTISSRADDLPPQPRRLEVVSKQATRVTALSTKLEWKIEQFEKLMKLIKNGSN-LISR 71

  Fly   727 LLEHKDALRDAISQICMLVRKQEFTQSVIELGLLDDTCLLSNNLKMADHENNLN-----QGLSEK 786
            :....||     ..:|.            ||.:..       |.|..:..||::     .||:..
 Worm    72 MFSVPDA-----PTVCW------------ELHVYP-------NGKRDEDVNNVSFFLRQVGLARG 112

  Fly   787 DSMYLDRKQYY--DYNSIKLNLIRHLCE-------PPIAASSNLSKNALRLLHSTQLADMEFEVH 842
            :...:...|.|  |.|:.::::.|...:       .....|.:....|||   |.....:..||.
 Worm   113 EEPIMTEFQIYALDANNQRVSVCRDTKDFTNQQGRGKFQVSRDKMLGALR---SDGTLFLICEVE 174

  Fly   843 TYAPTSGAA--------KSGGGTEAVPETAEPAAK------------VLQVHS--FKAHRVIVAA 885
            .:.|.|..:        .|....|.:||....|..            |:.|.:  .||||.|:..
 Worm   175 YFPPGSKISVEPVVDEDVSTEEQEEMPEVIVRANNRSMWEDELFTDCVIHVGNKHIKAHRCILGQ 239

  Fly   886 RCEWFKKALMS-GMQESINRKVIITDTSPVIFRRLLLYLYGAPIDRTVGAEQVCELMLLADRYSI 949
            ....||....| .|.|:...::.|.|......|.::.::|....:.......:.|::.:||:|.:
 Worm   240 NSPVFKSMFSSPNMIEAQKGEIHIEDAKYDSVRAMVEFMYTGATESLESQGNIDEILAIADKYEV 304

  Fly   950 DDLKELCENTLYSLIDEDSVVCLLGIADRYMATALKSKCLSFLSQHAQLT-KCEIFKELPQT--- 1010
            ..||:.||..:...|:..:|..:...:|.|.|..|||..:.||:.|.::. |.:.:..|.::   
 Worm   305 LMLKDQCERLIAQTINLKNVTQIAMFSDTYTADYLKSAVIRFLTTHHRVVIKTQDWISLKKSRHE 369

  Fly  1011 LQLEVMDLIHWFGRVSEPWNDRGFKPRSSSRHSLKSPSKPRSRSRKSS 1058
            |..|:::.:     :|...:|...   :|:.....||...|.|.|:|:
 Worm   370 LANELLEAV-----LSTDQDDDDV---TSNIPISVSPPPARKRLRRSA 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7058NP_573327.2 BTB 870..964 CDD:197585 24/97 (25%)
BTB 870..960 CDD:279045 24/93 (26%)
SPOP_C_like 964..1016 CDD:269810 15/56 (27%)
bath-42NP_498784.1 MATH 47..174 CDD:238068 32/155 (21%)
BTB 212..315 CDD:279045 24/103 (23%)
BTB 220..319 CDD:197585 24/99 (24%)
SPOP_C 319..380 CDD:269807 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000174
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.