DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18259 and AT1G66260

Sequence 1:NP_573324.1 Gene:CG18259 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001185329.1 Gene:AT1G66260 AraportID:AT1G66260 Length:295 Species:Arabidopsis thaliana

Alignment Length:181 Identity:43/182 (24%)
Similarity:69/182 (38%) Gaps:50/182 (27%)


  Fly   318 NRRKAVGGGGARDSDSGTDSDGDAAAPSKNKRRSPSPLSLRTS------------------NTKD 364
            :|:...|.||    .:|....|....|   .||.|..::.|.|                  |..|
plant    32 SRKSGRGRGG----PNGVVGGGRGGGP---VRRGPLAVNTRPSSSFSINKLARRKRSLPWQNQND 89

  Fly   365 ----------------GYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIY 407
                            |..:.::||...||..|||||:::||.:      ||......|:|||:|
plant    90 LYEETLRAVGVSGVEVGTTVYITNLDQGVTNEDIRELYAEIGELKRYAIHYDKNGRPSGSAEVVY 154

  Fly   408 KSLEHAEKAVDTYHHRQFDDQPMHCVLVNPHSSRRSVHKASSRTVTTNSSG 458
            .....|.:|:..|::...|.:||...::..::....|   ::|...|..:|
plant   155 MRRSDAIQAMRKYNNVLLDGRPMKLEILGGNTESAPV---AARVNVTGLNG 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 32/138 (23%)
RRM_SKAR 366..434 CDD:241125 24/74 (32%)
AT1G66260NP_001185329.1 RRM <107..>181 CDD:223796 24/74 (32%)
RRM_THOC4 107..181 CDD:241124 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19965
Phylome 1 0.910 0.750 Consistency score
22.010

Return to query results.
Submit another query.