DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and Alyref

DIOPT Version :8

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_006247987.1 Gene:Alyref / 690585 RGDID:1594679 Length:256 Species:Rattus norvegicus

Alignment Length:201 Identity:56/202 (28%)
Similarity:78/202 (39%) Gaps:50/202 (25%)


  Fly   304 KRDPHISHGIYANENRRKAVGGG---GARDSDSGTDSDGDAAA-------PSKNK---------- 348
            |.|..:...|..|.::|...|||   |...|..|......|||       |.:|:          
  Rat     4 KMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGAVQAAARVNRGGGPMRNRPAIARGAAGG 68

  Fly   349 --RRSPSPLSLRTSNTKD-------------------GYRLLVSNLHTNVTTADIRELFSDIGPV 392
              |..|:|.| |.....|                   |.:||||||...|:.|||:|||::.|.:
  Rat    69 GGRNRPAPYS-RPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTL 132

  Fly   393 ------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPH--SSRRSVHKASS 449
                  ||......|||:|.::....|.||:..|:....|.:||:..||...  :.||.....:.
  Rat   133 KKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDTQRRPAQSINR 197

  Fly   450 RTVTTN 455
            ..:|.|
  Rat   198 GGMTRN 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 39/137 (28%)
RRM_SKAR 366..434 CDD:241125 27/74 (36%)
AlyrefXP_006247987.1 RRM <107..>183 CDD:223796 29/76 (38%)
RRM_THOC4 107..180 CDD:241124 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.