DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18259 and Alyref2

Sequence 1:NP_573324.1 Gene:CG18259 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_062357.3 Gene:Alyref2 MGIID:1913144 Length:218 Species:Mus musculus

Alignment Length:181 Identity:52/182 (29%)
Similarity:74/182 (41%) Gaps:36/182 (20%)


  Fly   304 KRDPHISHGIYANENRRKAVGGGGARDSDSGTDSDGDAAAPSKNKRRSPSPLSLRTSNTKD---- 364
            |.|..:...|..|.|:|:...|||.|         .:..|.::..|..|:|.| |.....|    
Mouse     4 KMDMSLDDIIKLNRNQRRVNRGGGPR---------RNRPAIARGGRNRPAPYS-RPKPLPDKWQH 58

  Fly   365 ---------------GYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIYK 408
                           |.:||||||...|:.|||:|||::.|.:      ||......|||:|.::
Mouse    59 DLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFE 123

  Fly   409 SLEHAEKAVDTYHHRQFDDQPMHCVLVNPH-SSRRSVHKASSRTVTTNSSG 458
            ....|.||:..|.....|.:||...||... ..:|...::.:|...|.|.|
Mouse   124 RRADALKAMKQYKGVPLDGRPMDIQLVTSQIDPQRRPAQSGNRGGMTRSRG 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 37/124 (30%)
RRM_SKAR 366..434 CDD:241125 27/74 (36%)
Alyref2NP_062357.3 RRM_THOC4 75..149 CDD:241124 27/74 (36%)
FYTT 3..>32 CDD:284488 10/37 (27%)
Sufficient for RNA-binding, interaction with NXF1-NXT1 16..37 8/30 (27%)
Interaction with HHV-8 ORF57 protein and with ICP27 from HHV-1 54..155 31/101 (31%)
RRM <75..>157 CDD:223796 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.