DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18259 and SPBC106.12c

Sequence 1:NP_573324.1 Gene:CG18259 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_595161.1 Gene:SPBC106.12c PomBaseID:SPBC106.12c Length:274 Species:Schizosaccharomyces pombe

Alignment Length:230 Identity:55/231 (24%)
Similarity:80/231 (35%) Gaps:62/231 (27%)


  Fly   273 NTTKEPLERRH-RDTASTSKLPESLRSRL-FVGKRDPHISHGIYANENRRKAVGGGGARDSDSGT 335
            |......:.:| |...|.:::  |.:||| :..||        .:.|:......|....|.|.  
pombe    12 NERTNGFDHKHSRRRGSQNRI--SKKSRLTYKFKR--------ASKEHNSSPDDGPWQHDLDQ-- 64

  Fly   336 DSDGDAAAPSKNKRRSPSPLSLRTSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPV-----YDA 395
            :.|.........||:.        |..:.|.|  |.|||..|...|:..||.:..|:     ||.
pombe    65 EQDAHPRTTHLQKRQH--------SENRFGVR--VENLHYQVLEKDVLSLFENFHPIRVIMNYDR 119

  Fly   396 RVVRPGTAEVIYKSLEHAEKAVDTYHHRQ----------------FD---DQPMHCVLVNPHSSR 441
            .....|:.:|.:::.:.||.|..|.....                ||   |.| |.......|||
pombe   120 AGRSEGSCDVYFETSQDAEDAQKTLQSTNLKGSEIQISKKSPPSLFDRISDMP-HSARKPSRSSR 183

  Fly   442 ------RSVHK------ASSRTVTTNSSGVEVDID 464
                  ||..|      :||:..:.||...| |:|
pombe   184 SNRGFNRSSKKDDRSFRSSSKKSSNNSISHE-DLD 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 31/128 (24%)
RRM_SKAR 366..434 CDD:241125 23/92 (25%)
SPBC106.12cNP_595161.1 RRM 1..229 CDD:223796 55/231 (24%)
RRM_Aly_REF_like 87..158 CDD:240864 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19965
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.