DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18259 and Gm4307

Sequence 1:NP_573324.1 Gene:CG18259 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001160113.1 Gene:Gm4307 MGIID:3782487 Length:289 Species:Mus musculus

Alignment Length:196 Identity:53/197 (27%)
Similarity:78/197 (40%) Gaps:31/197 (16%)


  Fly   286 TASTSKLPESLR-----SRLFVGKRDPHISHGIYANENRRKAVGGGGARDSDSGTDSDGDAAAPS 345
            |....|:..||.     :::..|:||         ..:.|...|.|..|...:.|....:..||.
Mouse     2 TTMADKMDMSLEDIIKLNKMQQGRRD---------RPDSRVKRGTGPKRYRPAFTHGGRNRLAPY 57

  Fly   346 KNKRRSPSPL-------SLRTSNTKD-GYRLLVSNLHTNVTTADIRELFSDIGPV------YDAR 396
            ...::.|...       ..|..|..| |.:|.:||||..|:.|||:.||::.|.:      ||..
Mouse    58 CRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYDRC 122

  Fly   397 VVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPHSSR--RSVHKASSRTVTTN-SSG 458
            ....|||.|.::....|.||:..|:....|.:||:..||.....|  |....:....:|.| .||
Mouse   123 GRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDRQGRPALNSDKGGMTRNPGSG 187

  Fly   459 V 459
            |
Mouse   188 V 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 34/114 (30%)
RRM_SKAR 366..434 CDD:241125 25/74 (34%)
Gm4307NP_001160113.1 FYTT 6..>59 CDD:284488 13/62 (21%)
RRM <79..>163 CDD:223796 30/84 (36%)
RRM_THOC4 86..160 CDD:241124 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.