DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and ADF4

DIOPT Version :10

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_851228.1 Gene:ADF4 / 836111 AraportID:AT5G59890 Length:139 Species:Arabidopsis thaliana


Alignment Length:132 Identity:44/132 - (33%)
Similarity:82/132 - (62%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGINLSRECQHVFEQIRKLKQHRYAVFVIQD-EREIKVEVLGVREANYDDFLADLQRAGSNQCR 65
            |||:.:..:|:..|.:::..:.||:.|:.|:: ::::.||.:|.....|:||.|.|.   :::||
plant     5 ASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASLP---ADECR 66

  Fly    66 FAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLKREFPGVQKCIQATEP 130
            :|:||:::.     |...|.|.|:..:.|||.:|:::.||:|:|:....|||..|:|..:|||:|
plant    67 YAIYDFDFV-----TAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDP 126

  Fly   131 EE 132
            .|
plant   127 TE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 43/131 (33%)
ADF4NP_851228.1 ADF_cofilin_like 6..138 CDD:200442 43/131 (33%)

Return to query results.
Submit another query.