DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and ADF7

DIOPT Version :10

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_194289.2 Gene:ADF7 / 828664 AraportID:AT4G25590 Length:137 Species:Arabidopsis thaliana


Alignment Length:131 Identity:47/131 - (35%)
Similarity:79/131 - (60%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGINLSRECQHVFEQIRKLKQHRYAVFVIQDEREIKVEVLGVREANYDDFLADLQRAGSNQCRF 66
            |||:.:..||:..|.:::..:.:|:.:|.| |.:::.||.||..:..||||.|.|.   :|:||:
plant     5 ASGMAVEDECKLKFLELKSKRNYRFIIFRI-DGQQVVVEKLGNPDETYDDFTASLP---ANECRY 65

  Fly    67 AVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLKREFPGVQKCIQATEPE 131
            ||:|:::.     |...|.|.|:..:.|.|..:|::.||:|:|:....|||..|:|..:|||:|.
plant    66 AVFDFDFI-----TDENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPS 125

  Fly   132 E 132
            |
plant   126 E 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 46/130 (35%)
ADF7NP_194289.2 ADF_cofilin_like 6..136 CDD:200442 46/130 (35%)

Return to query results.
Submit another query.