DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and DPB

DIOPT Version :9

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_850757.1 Gene:DPB / 831847 AraportID:AT5G03415 Length:385 Species:Arabidopsis thaliana


Alignment Length:184 Identity:35/184 - (19%)
Similarity:67/184 - (36%) Gaps:53/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDTREQILEQIKVQGDLVRQLKAAKESKEKTAPSGGGRVSSSGVPAQRQQQQQ--PQKQQQA--- 61
            |||..|.|..:.:|||                  ..|...:|||..:::.|:.  |.|..:.   
plant    60 SDTTFQRLNNLDIQGD------------------DAGSQGASGVKKKKRGQRAAGPDKTGRGLRQ 106

  Fly    62 -------QVQQQQHEQLHQIDEEVARLLALKATLGGDAAPTNQKFTLKTPKGTRDYGPQQMTLRQ 119
                   :|:.:.....:::.:|:....||....|  .:|..|::             .:..:|:
plant   107 FSMKVCEKVESKGRTTYNEVADELVAEFALPNNDG--TSPDQQQY-------------DEKNIRR 156

  Fly   120 GVLDKIVQVFKRHGGEAIDTPVFELKEVLTGKYGEDSKLIYDLKDQGGEILSMR 173
            .|.|.:..:.      |:|....:.||:..  .|.....:.|:::...|.||:|
plant   157 RVYDALNVLM------AMDIISKDKKEIQW--RGLPRTSLSDIEELKNERLSLR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248 17/97 (18%)
HisS 98..561 CDD:223202 13/76 (17%)
HisRS-like_core 114..452 CDD:238396 13/60 (22%)
HisRS_anticodon 467..557 CDD:238436
DPBNP_850757.1 E2F_TDP 101..182 CDD:280479 14/103 (14%)
coiled coil 187..233 CDD:271217 5/16 (31%)
DP 189..>295 CDD:285934 5/14 (36%)
Neural_ProG_Cyt 276..>320 CDD:284080
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.